TkA08G394830 | RubberDandelionOmics

Gene overview

TkA08G394830

Reference: TK1151 Chr: Chr08 Coordinates: 100699297-100700656 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

910 bp · TkA08G394830|TK1151|cDNA

CTAAAACCATGTGTGGGTAAACTGAAAATCGTATACATATACTGTTTGTGGATGATGTATGAGCGAATCTAATCCTTTTTGGACATTTCAAAGCGAATATAACAGATAATAACCGAGCAAACACTACAATGGAATCAGTTATTGCGTGCCCTTCCTATGTACCTGGATTGCATTCCATCTTTGCATTTACCACATCGAAGCTTGCAAGGCTCAGTTTTTCTCTAAATGATGGAAGCACCCTCCAATTTCCTATATCAAAC...

CDS

Download CDS FASTA

660 bp · TkA08G394830|TK1151|CDS

ATGGAATCAGTTATTGCGTGCCCTTCCTATGTACCTGGATTGCATTCCATCTTTGCATTTACCACATCGAAGCTTGCAAGGCTCAGTTTTTCTCTAAATGATGGAAGCACCCTCCAATTTCCTATATCAAACATTAAAACCAATGGAGATAAAAGAGTAAGATTTTCACAAAGAAATCATGATACTGGAAGACCAATAAATGGTGAGGATAACAAGACACCTCAATTATCATCTGAAGAAAAAACATATAATAAAGAAGA...

Protein

Download Protein FASTA

219 aa · TkA08G394830|TK1151|PROTEIN

MESVIACPSYVPGLHSIFAFTTSKLARLSFSLNDGSTLQFPISNIKTNGDKRVRFSQRNHDTGRPINGEDNKTPQLSSEEKTYNKEEILALFRRIQSSISGESKGRTNNASAESVLEVLRQSRKQIKGKTSNREGGIVSDERKKYEKKEEIVDAKMSRPPSNFVKRSPIPFVETIEDEVKSEGLETMKLVALKELAKSRGIKGYSKLKKAELIQLLRTV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G394830`
TK1151 ID	TkA08G394830
OH-1004 ID	LXL04_034429
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G394830`
Location	Chr08:100699297-100700656 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_034429` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006353 DNA-templated transcription termination Biological Process GO:0006412 translation Biological Process GO:0010239 chloroplast mRNA processing Biological Process GO:1901259 chloroplast rRNA processing Biological Process GO:0009507 chloroplast Cellular Component GO:0022627 cytosolic small ribosomal subunit Cellular Component GO:0003677 DNA binding Molecular Function GO:0003729 mRNA binding Molecular Function GO:0003735 structural constituent of ribosome Molecular Function GO:0019843 rRNA binding Molecular Function
KEGG gene cross-reference	acl:ACL_1157 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.973

Rank 1 · TkA08G394830 · TK1151

Nucleus0.041

Rank 2 · TkA08G394830 · TK1151

Mitochondrion0.022

Rank 3 · TkA08G394830 · TK1151

Cytoplasm0.018

Rank 4 · TkA08G394830 · TK1151

Cell membrane0.011

Rank 5 · TkA08G394830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17027Bromo_TP_like78-129 aa

PF07766LETM1_RBD85-124 aa

PF26521MAFA_adhesin90-154 aa

PF24224DUF7440173-209 aa

PF07766LETM1_RBD178-216 aa

PF07498Rho_N184-213 aa

PF02037SAP184-202 aa

PF12949HeH186-217 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G394830	`PF17027`	Bromo_TP_like	78	129	0.059	14.2
TkA08G394830	`PF07766`	LETM1_RBD	85	124	0.24	11.6
TkA08G394830	`PF26521`	MAFA_adhesin	90	154	0.012	16.1
TkA08G394830	`PF24224`	DUF7440	173	209	0.0099	16.7
TkA08G394830	`PF07766`	LETM1_RBD	178	216	0.24	11.6
TkA08G394830	`PF07498`	Rho_N	184	213	3.9e-08	33.9
TkA08G394830	`PF02037`	SAP	184	202	0.00074	19.8
TkA08G394830	`PF12949`	HeH	186	217	0.18	12.3
TkA08G394830	`PF17027`	Bromo_TP_like	190	217	0.059	14.2
TkA08G394830	`PF02037`	SAP	204	218	0.00074	19.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card