TkA08G392480 | RubberDandelionOmics

Gene overview

TkA08G392480

Reference: TK1151 Chr: Chr08 Coordinates: 100023240-100032172 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4317 bp · TkA08G392480|TK1151|cDNA

AAGGATTTGACTTCTCACAGATGAGTGATGACAAAAGCTCTACTGACTGCTTATCATAAGAAAAATGTTACAATAATCTTTCTACTCTCCTTTGTAAATTGCATAGCGACATGGATATGATAAGTAGCCAAATTTTCGTCGCCACCAGCCAAGAATGTGGGCCAATCTATTTGTCGTACTAACGATTTTCGATCATGCCCTCTTTCAGATTGTTCGTAAGCAGTGACGATCACACGATTAATCATTTTATCACACCCCTT...

CDS

Download CDS FASTA

1854 bp · TkA08G392480|TK1151|CDS

ATGGGATTTGAGCCACTGGTTTGGTTTTGCCGGCCGGAGGAAAATGGCATTTGGGCAAAAACAACCGCGAGTGCTCTTGGTGCTTATACACCATGTGGCATCGAATCAGTTGTGGGTTGCATATCAAACGTCGTTTTAATGGGGCTGTGCTTATACAGACTATGGTTGATGATGAGAGACTTTAGAGTCCAGAGGTTCTGCTTAAGGTCAAAGCGGTATAACTATATATTGGCCATTTTAGCAGGCTATTGTGCTTCAGA...

Protein

Download Protein FASTA

617 aa · TkA08G392480|TK1151|PROTEIN

MGFEPLVWFCRPEENGIWAKTTASALGAYTPCGIESVVGCISNVVLMGLCLYRLWLMMRDFRVQRFCLRSKRYNYILAILAGYCASESLYRLLFDVSMFDFDAQSSLAPFEVVSLFLETLVWSCLVIMSLLETKVYIREFRWYVRFGVLYVLVGDTVKLSLILSVKDLYPSSVLYLYISSLLCQALFGALIVAYVPNLDTYMGYIPLQSDPVDDIIKYEMLRGGEHICPERHAHIFSRIYFGWMTPLMEQGYRKPITEKD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G392480`
TK1151 ID	TkA08G392480
OH-1004 ID	LXL04_034450
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.300
Protein coverage (%)	TK1151 87.358 / OH-1004 27.245 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G392480

Location Chr08:100023240-100032172 (+)

Description Similar to ABCC12: ABC transporter C family member 12

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g30410`	Pump for glutathione S-conjugates.	No verified direct reference in this release
`At2g34660`	Pump for glutathione S-conjugates.	Enhanced multispecificity of arabidopsis vacuolar multidrug resistance-associated protein-type ATP-binding cassette transporter, AtMRP2.2001 · DOI: 10.1074/jbc.m009690200 AtMRP2, an Arabidopsis ATP binding cassette transporter able to transport glutathione S-conjugates and chlorophyll catabolites: functional comparisons with Atmrp1.1998 · DOI: 10.1105/tpc.10.2.267
`At1g30400`	Pump for glutathione S-conjugates.	AtMRP1 gene of Arabidopsis encodes a glutathione S-conjugate pump: isolation and functional definition of a plant ATP-binding cassette transporter gene.1997 · DOI: 10.1073/pnas.94.15.8243
`At1g30420`	Pump for glutathione S-conjugates.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034450 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006869 lipid transport Biological Process

GO:0015700 arsenite transport Biological Process

GO:0034775 glutathione transmembrane transport Biological Process

GO:0042908 xenobiotic transport Biological Process

GO:0046685 response to arsenic-containing substance Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0070729 cyclic nucleotide transport Biological Process

GO:1902418 (+)-abscisic acid D-glucopyranosyl ester transmembrane transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

KEGG gene cross-reference

ath:AT1G30400

ath:AT1G30410

ath:AT1G30420

ath:AT2G34660

gga:395416

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.378

Rank 1 · TkA08G392480 · TK1151

Lysosome / Vacuole0.312

Rank 2 · TkA08G392480 · TK1151

Cytoplasm0.245

Rank 3 · TkA08G392480 · TK1151

Golgi apparatus0.124

Rank 4 · TkA08G392480 · TK1151

Endoplasmic reticulum0.123

Rank 5 · TkA08G392480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28353CLP1_C34-58 aa

PF00664ABC_membrane41-82 aa

PF28674Cu_res_D_N41-110 aa

PF00664ABC_membrane305-572 aa

PF28353CLP1_C407-443 aa

PF28674Cu_res_D_N438-463 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G392480	`PF28353`	CLP1_C	34	58	0.29	12.0
TkA08G392480	`PF00664`	ABC_membrane	41	82	4.2e-38	132.3
TkA08G392480	`PF28674`	Cu_res_D_N	41	110	2.7	9.0
TkA08G392480	`PF00664`	ABC_membrane	305	572	4.2e-38	132.3
TkA08G392480	`PF28353`	CLP1_C	407	443	0.29	12.0
TkA08G392480	`PF28674`	Cu_res_D_N	438	463	2.7	9.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C8H0`	Arabidopsis thaliana	sp\|Q9C8H0\|AB12C_ARATH ABC transporter C family member 12	64.200%	Swiss-Prot	High
`Q42093`	Arabidopsis thaliana	sp\|Q42093\|AB2C_ARATH ABC transporter C family member 2	62.900%	Swiss-Prot	High
`Q9C8G9`	Arabidopsis thaliana	sp\|Q9C8G9\|AB1C_ARATH ABC transporter C family member 1	62.100%	Swiss-Prot	High
`Q9C8H1`	Arabidopsis thaliana	sp\|Q9C8H1\|AB11C_ARATH ABC transporter C family member 11	61.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card