TkA08G370500 | RubberDandelionOmics

Gene overview

TkA08G370500

Reference: TK1151 Chr: Chr08 Coordinates: 94869104-94871438 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1386 bp · TkA08G370500|TK1151|cDNA

ATGGTGGAGGACTTGTGGAATAATGATGACATTCTTGAACTAAATGCTATTATTCGCCTCAAAAAGAATATTCAGGCCTTTAAAGTGAAGTTGAAGTCTTGGAACGGTTCTTTGCGCCAATGTCGGGAAGCTGATCGGGTATGGTTGCAAACGGAGTTGGTGGATATTGAGATCCAGTTGGACGAGGGTTTGGTTCCCGATCCCTCCCTTAACTCTCGGTTCTCTATTGTTAAACAAATTTCGAATATTAATCGTGTTGC...

CDS

Download CDS FASTA

1386 bp · TkA08G370500|TK1151|CDS

ATGGTGGAGGACTTGTGGAATAATGATGACATTCTTGAACTAAATGCTATTATTCGCCTCAAAAAGAATATTCAGGCCTTTAAAGTGAAGTTGAAGTCTTGGAACGGTTCTTTGCGCCAATGTCGGGAAGCTGATCGGGTATGGTTGCAAACGGAGTTGGTGGATATTGAGATCCAGTTGGACGAGGGTTTGGTTCCCGATCCCTCCCTTAACTCTCGGTTCTCTATTGTTAAACAAATTTCGAATATTAATCGTGTTGC...

Protein

Download Protein FASTA

461 aa · TkA08G370500|TK1151|PROTEIN

MVEDLWNNDDILELNAIIRLKKNIQAFKVKLKSWNGSLRQCREADRVWLQTELVDIEIQLDEGLVPDPSLNSRFSIVKQISNINRVASLDAAQKDKVKWAMEGYGNSSFFHDPDRLKREFLFHFSDRFAKPTPFRASIVSEFLSQLTDQHHLDLETTASCKKAMVFKVDFEKVYDTLRWDFLDDVLLAFGFGPNWRSWIRGCLVSSMGSAMVNGSLTPEFKLTQVKAVLGALPTYFFSIYKAPMAVLSQTESLWNNVFLG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G370500`
TK1151 ID	TkA08G370500
OH-1004 ID	LXL04_034149
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.200
Protein coverage (%)	TK1151 99.783 / OH-1004 49.093 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G370500`
Location	Chr08:94869104-94871438 (-)
Description	Similar to SCPL40: Serine carboxypeptidase-like 40
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_034149` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006508 proteolysis Biological Process GO:0009610 response to symbiotic fungus Biological Process GO:0009742 brassinosteroid mediated signaling pathway Biological Process GO:0036377 arbuscular mycorrhizal association Biological Process GO:0005576 extracellular region Cellular Component GO:0005615 extracellular space Cellular Component GO:0005773 vacuole Cellular Component GO:0048046 apoplast Cellular Component GO:0004185 serine-type carboxypeptidase activity Molecular Function
KEGG gene cross-reference	ath:AT3G52020 ath:AT3G63470 ath:AT4G30610 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.584

Rank 1 · TkA08G370500 · TK1151

Nucleus0.423

Rank 2 · TkA08G370500 · TK1151

Cell membrane0.060

Rank 3 · TkA08G370500 · TK1151

Endoplasmic reticulum0.044

Rank 4 · TkA08G370500 · TK1151

Golgi apparatus0.035

Rank 5 · TkA08G370500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25651Baculo_P1517-58 aa

PF00078RVT_1143-215 aa

PF25651Baculo_P15147-172 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G370500	`PF25651`	Baculo_P15	17	58	0.036	15.1
TkA08G370500	`PF00078`	RVT_1	143	215	0.00028	21.6
TkA08G370500	`PF25651`	Baculo_P15	147	172	0.036	15.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card