TkA08G365240 | RubberDandelionOmics

Gene overview

TkA08G365240

Reference: TK1151 Chr: Chr08 Coordinates: 93557627-93565620 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2330 bp · TkA08G365240|TK1151|cDNA

TTGAACTCATCTAACAAGAGGAGTCTAATGTATCCTGGTTTGCTCTTTCTGTACGCCTTAACCTTGAGCATTTTTTCAGCAGATGTTGGTATAATTCATGCAGATACATCATGCATAGCAGGAGCAGCAGCAGGAGCAGGAAGATCGTCAATGACAGGCATAACAGATATGGTGAACTTATCTTTCCAAGAGAATCATGTGGTAATGAATAATGGCATTGTCCAAATCACTCTTTCAAATCCAGATGGACATCTTACCGG...

CDS

Download CDS FASTA

2058 bp · TkA08G365240|TK1151|CDS

ATGTATCCTGGTTTGCTCTTTCTGTACGCCTTAACCTTGAGCATTTTTTCAGCAGATGTTGGTATAATTCATGCAGATACATCATGCATAGCAGGAGCAGCAGCAGGAGCAGGAAGATCGTCAATGACAGGCATAACAGATATGGTGAACTTATCTTTCCAAGAGAATCATGTGGTAATGAATAATGGCATTGTCCAAATCACTCTTTCAAATCCAGATGGACATCTTACCGGCATACAATACAAAGGAATCGACAATTT...

Protein

Download Protein FASTA

685 aa · TkA08G365240|TK1151|PROTEIN

MYPGLLFLYALTLSIFSADVGIIHADTSCIAGAAAGAGRSSMTGITDMVNLSFQENHVVMNNGIVQITLSNPDGHLTGIQYKGIDNLLEIRNGEYNRGYWDVVWSPSGSAGTKGTLERLAGTSCEVIVQTKDQVEISFSRTWDSSQQGKLVPLKIDKRYILLRGSSGFYTYAIYEHLEEWPSFNLDNTRIAFKLRKDKFHYMAMSDDRQRDMPLPDDRLPERGKQLAYPEAVLLVDPVEPKFKGQVDDKYQYACELKDLK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G365240`
TK1151 ID	TkA08G365240
OH-1004 ID	LXL04_031100
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	52.300
Protein coverage (%)	TK1151 92.993 / OH-1004 93.468 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G365240`
Location	Chr08:93557627-93565620 (-)
Description	Similar to rhiE: Rhamnogalacturonate lyase (Dickeya dadantii (strain 3937)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_031100` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000272 polysaccharide catabolic process Biological Process GO:0005975 carbohydrate metabolic process Biological Process GO:0045490 pectin catabolic process Biological Process GO:0071555 cell wall organization Biological Process GO:0005576 extracellular region Cellular Component GO:0004112 cyclic-nucleotide phosphodiesterase activity Molecular Function GO:0016837 carbon-oxygen lyase activity, acting on polysaccharides Molecular Function GO:0030246 carbohydrate binding Molecular Function GO:0102210 rhamnogalacturonan endolyase activity Molecular Function
KEGG gene cross-reference	ang:An11g00390 ani:ANIA_04139 ani:ANIA_06395 ddd:Dda3937_01465 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.267

Rank 1 · TkA08G365240 · TK1151

Extracellular0.252

Rank 2 · TkA08G365240 · TK1151

Endoplasmic reticulum0.205

Rank 3 · TkA08G365240 · TK1151

Cytoplasm0.168

Rank 4 · TkA08G365240 · TK1151

Cell membrane0.090

Rank 5 · TkA08G365240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14683CBM-like39-70 aa

PF06045Rhamnogal_lyase43-246 aa

PF14686fn3_3241-254 aa

PF14686fn3_3400-472 aa

PF13620CarboxypepD_reg427-459 aa

PF22904NOMO1-like_2nd427-457 aa

PF14683CBM-like487-674 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G365240	`PF14683`	CBM-like	39	70	3.4e-45	154.5
TkA08G365240	`PF06045`	Rhamnogal_lyase	43	246	6.5e-95	317.2
TkA08G365240	`PF14686`	fn3_3	241	254	3e-27	94.9
TkA08G365240	`PF14686`	fn3_3	400	472	3e-27	94.9
TkA08G365240	`PF13620`	CarboxypepD_reg	427	459	0.15	13.2
TkA08G365240	`PF22904`	NOMO1-like_2nd	427	457	0.24	12.3
TkA08G365240	`PF14683`	CBM-like	487	674	3.4e-45	154.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card