TkA08G354610 | RubberDandelionOmics

Gene overview

TkA08G354610

Reference: TK1151 Chr: Chr08 Coordinates: 90866603-90867601 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

939 bp · TkA08G354610|TK1151|cDNA

ATGTCCTTCTCCTTTGCTCCATTGCCTTTATCTCACCCCGATGAGATACTCCATGATTATTCCCCTTTTATACTAATCCACAAAAATGGTCGCATTGAACGGCTAGTTGGAGTAGAGACCACCCCACCATCAACAGACCACACCACCGGAGTCCGCTCCAAAGATGTTCAAATCTCACCGGAAACAGGCCTCTCCGTCAGGATTTACTTGCCACCAACAAATACATCCAAACCCCAGAAACTGCCTGTCCTTATTTACTT...

CDS

Download CDS FASTA

939 bp · TkA08G354610|TK1151|CDS

ATGTCCTTCTCCTTTGCTCCATTGCCTTTATCTCACCCCGATGAGATACTCCATGATTATTCCCCTTTTATACTAATCCACAAAAATGGTCGCATTGAACGGCTAGTTGGAGTAGAGACCACCCCACCATCAACAGACCACACCACCGGAGTCCGCTCCAAAGATGTTCAAATCTCACCGGAAACAGGCCTCTCCGTCAGGATTTACTTGCCACCAACAAATACATCCAAACCCCAGAAACTGCCTGTCCTTATTTACTT...

Protein

Download Protein FASTA

312 aa · TkA08G354610|TK1151|PROTEIN

MSFSFAPLPLSHPDEILHDYSPFILIHKNGRIERLVGVETTPPSTDHTTGVRSKDVQISPETGLSVRIYLPPTNTSKPQKLPVLIYFHGGGFVFGTAFSTMFQPFHNKLCLEANTIIVSVDYRCAPEHLYPVQYDDSWDAIKWVASHGSTNGTEPWLNEYADFERLFFGGESAGANIAHHMGIVLIDPHFWGETLIGGEVVADVKERNILEKLWRIMNPSFSSFDDPLINPAKDPNLSKLGCERVLVSVAEKDLLRDRGW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G354610`
TK1151 ID	TkA08G354610
OH-1004 ID	LXL04_034096
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	72.000
Protein coverage (%)	TK1151 100.000 / OH-1004 83.838 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G354610

Location Chr08:90866603-90867601 (-)

Description Similar to CXE13: Probable carboxylesterase 13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g48700`	Carboxylesterase acting on esters with varying acyl chain length.	No verified direct reference in this release
`At3g48690`	Carboxylesterase acting on esters with varying acyl chain length.	No verified direct reference in this release
`At2g03550`	Carboxylesterase acting on esters with varying acyl chain length.	No verified direct reference in this release
`At1g47480`	Carboxylesterase acting on esters with varying acyl chain length.	No verified direct reference in this release
`At1g19190`	Carboxylesterase acting on esters with varying acyl chain length.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034096 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016787 hydrolase activity Molecular Function

GO:0106435 carboxylesterase activity Molecular Function

KEGG gene cross-reference

ath:AT1G19190

ath:AT1G47480

ath:AT2G03550

ath:AT3G48690

ath:AT3G48700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.862

Rank 1 · TkA08G354610 · TK1151

Nucleus0.339

Rank 2 · TkA08G354610 · TK1151

Endoplasmic reticulum0.050

Rank 3 · TkA08G354610 · TK1151

Cell membrane0.031

Rank 4 · TkA08G354610 · TK1151

Peroxisome0.030

Rank 5 · TkA08G354610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00135COesterase55-125 aa

PF00756Esterase64-127 aa

PF20434BD-FAE68-183 aa

PF10340Say1_Mug18074-134 aa

PF07859Abhydrolase_384-288 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G354610	`PF00135`	COesterase	55	125	2.6e-09	37.3
TkA08G354610	`PF00756`	Esterase	64	127	0.066	13.7
TkA08G354610	`PF20434`	BD-FAE	68	183	9.1e-13	48.9
TkA08G354610	`PF10340`	Say1_Mug180	74	134	0.0019	17.8
TkA08G354610	`PF07859`	Abhydrolase_3	84	288	5.5e-45	154.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SMM9`	Arabidopsis thaliana	sp\|Q9SMM9\|CXE13_ARATH Probable carboxylesterase 13	48.200%	Swiss-Prot	Medium
`Q9SMN0`	Arabidopsis thaliana	sp\|Q9SMN0\|CXE12_ARATH Probable carboxylesterase 12	46.400%	Swiss-Prot	Medium
`Q9ZQ91`	Arabidopsis thaliana	sp\|Q9ZQ91\|CXE7_ARATH Probable carboxylesterase 7	46.800%	Swiss-Prot	Medium
`Q9SX78`	Arabidopsis thaliana	sp\|Q9SX78\|CXE2_ARATH Probable carboxylesterase 2	44.200%	Swiss-Prot	Medium
`Q9LMA7`	Arabidopsis thaliana	sp\|Q9LMA7\|CXE1_ARATH Probable carboxylesterase 1	44.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card