TkA08G348520 | RubberDandelionOmics

Gene overview

TkA08G348520

Reference: TK1151 Chr: Chr08 Coordinates: 89312088-89314110 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

762 bp · TkA08G348520|TK1151|cDNA

CAATTAATTCACTTAAGTTACTTCTGTGGTTTCCAACTTTTTACCCTGCTATGTTGATTGAAACCTGTAGTGTGATAGGGCTGAATTTCGATTTCGTGGTGCTGAATCTGACTAAGCATTCGTCGTATCTGATATACAACGCCTCCGTCTTCTTTAGCTCCGCCGTTCAACGTCAGTATCACCAGAAATATGGCTTCAATAAGATGATACCTGTAGCAGCAAACGATGTTGCTTTCTCCATTCACGCAGTTGTCCTAACT...

CDS

Download CDS FASTA

549 bp · TkA08G348520|TK1151|CDS

ATGTTGATTGAAACCTGTAGTGTGATAGGGCTGAATTTCGATTTCGTGGTGCTGAATCTGACTAAGCATTCGTCGTATCTGATATACAACGCCTCCGTCTTCTTTAGCTCCGCCGTTCAACGTCAGTATCACCAGAAATATGGCTTCAATAAGATGATACCTGTAGCAGCAAACGATGTTGCTTTCTCCATTCACGCAGTTGTCCTAACTGCATTTACCTTATTCCAGATAGCCATCTATGATCGTGGAGGTCAAAAGGT...

Protein

Download Protein FASTA

182 aa · TkA08G348520|TK1151|PROTEIN

MLIETCSVIGLNFDFVVLNLTKHSSYLIYNASVFFSSAVQRQYHQKYGFNKMIPVAANDVAFSIHAVVLTAFTLFQIAIYDRGGQKVSKTSISILSVAWLTVIICVFIAIPNHSWLWLVSCFSTLQVVMTVIKYITQAVMNFKRKSTVGFSIGNILLDLLGGLANYGQMAVQSIDQHSWVNF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G348520`
TK1151 ID	TkA08G348520
OH-1004 ID	LXL04_006080
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.900
Protein coverage (%)	TK1151 96.703 / OH-1004 65.428 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G348520

Location Chr08:89312088-89314110 (+)

Description Similar to At5g40670: Cystinosin homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g40670`	Thought to transport cystine out of lysosomes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006080 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006520 amino acid metabolic process Biological Process

GO:0006749 glutathione metabolic process Biological Process

GO:0010730 negative regulation of hydrogen peroxide biosynthetic process Biological Process

GO:0010918 positive regulation of mitochondrial membrane potential Biological Process

GO:0015031 protein transport Biological Process

GO:0015811 L-cystine transport Biological Process

GO:0035623 renal D-glucose absorption Biological Process

GO:0035672 oligopeptide transmembrane transport Biological Process

GO:0042438 melanin biosynthetic process Biological Process

GO:0046034 ATP metabolic process Biological Process

GO:0048021 regulation of melanin biosynthetic process Biological Process

GO:0048731 system development Biological Process

KEGG gene cross-reference

ath:AT5G40670

bta:613527

ddi:DDB_G0279445

hsa:1497

mmu:83429

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.380

Rank 1 · TkA08G348520 · TK1151

Cell membrane0.237

Rank 2 · TkA08G348520 · TK1151

Cytoplasm0.224

Rank 3 · TkA08G348520 · TK1151

Golgi apparatus0.180

Rank 4 · TkA08G348520 · TK1151

Endoplasmic reticulum0.177

Rank 5 · TkA08G348520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04193PQ-loop7-35 aa

PF06271RDD62-118 aa

PF04193PQ-loop98-108 aa

PF04193PQ-loop119-175 aa

PF06271RDD124-149 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G348520	`PF04193`	PQ-loop	7	35	2.5e-13	50.3
TkA08G348520	`PF06271`	RDD	62	118	0.89	10.6
TkA08G348520	`PF04193`	PQ-loop	98	108	2.5e-13	50.3
TkA08G348520	`PF04193`	PQ-loop	119	175	2.5e-13	50.3
TkA08G348520	`PF06271`	RDD	124	149	0.89	10.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P57758`	Arabidopsis thaliana	sp\|P57758\|CTNS_ARATH Cystinosin homolog	68.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card