TkA08G341490 | RubberDandelionOmics

Gene overview

TkA08G341490

Reference: TK1151 Chr: Chr08 Coordinates: 87561666-87565503 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1377 bp · TkA08G341490|TK1151|cDNA

GTAAACTCCCTTTATGCTAAAATATCAAATTGGAAATTTCTTGGAAACTCCCATTGAGGTACTCAGACCATTATATACTTGCAATGTAACTTGGATCATAAAAGTCAACACATCGATGGCATCATCCTCATCGTCTCTTTCTGCTCCTGCCTTTTCTTCCACATCTTGGAAGTACCATGTCTTTCTTAGCTTTAGAGGAGACGATACTCGCAATACCTTTGCGGACCATCTTTACTCGGCTTTGGAACAAAGAGGTATCT...

CDS

Download CDS FASTA

741 bp · TkA08G341490|TK1151|CDS

ATGGAACTTTGGGGTGTGGAACAACTAGTCATGACACCAGATTTTGATGGGCTTCCAAATCTTGAAATACTCTCTCTTACTAGATGTTTGTATTTAGAAGAGATTCATCCATCAATTCAACGCTTGGAAAGGCTTGTTTCCTTAACTATTGAATTCTGTAACCGTCTTAAGACGTGTCCACCCATTACCCAACCAAAGAAACTTCAGACCCTTTCTTTCAGTCACTGCCCCATGCTAGGGCGTATTCATTTGGATGATGA...

Protein

Download Protein FASTA

247 aa · TkA08G341490|TK1151|PROTEIN

MELWGVEQLVMTPDFDGLPNLEILSLTRCLYLEEIHPSIQRLERLVSLTIEFCNRLKTCPPITQPKKLQTLSFSHCPMLGRIHLDDDEGKVASNRDSMTNSLGTWLTCLRSNHPGVEQPCLEEPCLRDNNMNPCFGLRYFLEGLRDLNLGWCRLGNEVIGTADWELPNLEELNLEYNKFSRLSFSRLRLPRLKFLNVRGCRGLVELLELPSSIFVVNADWCNSLQSFGDFKVQMAMESLKCLGEQSY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G341490`
TK1151 ID	TkA08G341490
OH-1004 ID	LXL04_025723
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 92.713 / OH-1004 10.538 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G341490`
Location	Chr08:87561666-87565503 (-)
Description	Similar to ROQ1: Disease resistance protein Roq1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_025723` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006952 defense response Biological Process GO:0007165 signal transduction Biological Process GO:0009626 plant-type hypersensitive response Biological Process GO:0019677 NAD+ catabolic process Biological Process GO:0043068 positive regulation of programmed cell death Biological Process GO:0050832 defense response to fungus Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0003953 NAD+ nucleosidase activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0043531 ADP binding Molecular Function GO:0050135 NADP+ nucleosidase activity Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.603

Rank 1 · TkA08G341490 · TK1151

Cytoplasm0.224

Rank 2 · TkA08G341490 · TK1151

Cell membrane0.182

Rank 3 · TkA08G341490 · TK1151

Endoplasmic reticulum0.074

Rank 4 · TkA08G341490 · TK1151

Plastid0.051

Rank 5 · TkA08G341490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25019LRR_R13L1-DRL212-29 aa

PF12799LRR_415-34 aa

PF13855LRR_815-54 aa

PF23598LRR_1418-73 aa

PF12799LRR_419-62 aa

PF13516LRR_619-29 aa

PF00560LRR_120-42 aa

PF23247LRR_RPS220-58 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G341490	`PF25019`	LRR_R13L1-DRL21	2	29	0.00016	22.3
TkA08G341490	`PF12799`	LRR_4	15	34	3.8e-09	37.2
TkA08G341490	`PF13855`	LRR_8	15	54	1.7e-07	31.6
TkA08G341490	`PF23598`	LRR_14	18	73	0.017	14.6
TkA08G341490	`PF12799`	LRR_4	19	62	3.8e-09	37.2
TkA08G341490	`PF13516`	LRR_6	19	29	2e-05	25.0
TkA08G341490	`PF00560`	LRR_1	20	42	8.2e-06	25.7
TkA08G341490	`PF23247`	LRR_RPS2	20	58	0.0032	18.2
TkA08G341490	`PF23286`	LRR_13	37	82	0.00056	20.4
TkA08G341490	`PF23952`	LRR_EndoS	39	86	0.24	12.3
TkA08G341490	`PF25019`	LRR_R13L1-DRL21	40	76	0.00016	22.3
TkA08G341490	`PF00560`	LRR_1	45	61	8.2e-06	25.7
TkA08G341490	`PF13516`	LRR_6	66	77	2e-05	25.0
TkA08G341490	`PF12799`	LRR_4	67	77	3.8e-09	37.2
TkA08G341490	`PF00560`	LRR_1	67	82	8.2e-06	25.7
TkA08G341490	`PF13855`	LRR_8	68	85	1.7e-07	31.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card