TkA08G320240 | RubberDandelionOmics

Gene overview

TkA08G320240

Reference: TK1151 Chr: Chr08 Coordinates: 82716098-82718951 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1866 bp · TkA08G320240|TK1151|cDNA

ATGAGCTCTGCAGAGGTGCTTGACCATGCATGCATCTGCCGCCATAGAGCCGAGACGAAGCTTGAGGTGAAATTCCATCACCTCGCTCTTCGGGACTTCATCAACTCAGTCATTCATGACTTCAGCTATGGAGATGCGGAGCTCCACTTGGAATTTCCTACTGCTCCTCCTCTTCCCAAAACAGGCACTTCATTTGAAGGCGTTGGCGACATCAGCAAGGGTTACACCTTGGAGCCAATTCGTGCCTTAGCATACGAAGA...

CDS

Download CDS FASTA

1866 bp · TkA08G320240|TK1151|CDS

ATGAGCTCTGCAGAGGTGCTTGACCATGCATGCATCTGCCGCCATAGAGCCGAGACGAAGCTTGAGGTGAAATTCCATCACCTCGCTCTTCGGGACTTCATCAACTCAGTCATTCATGACTTCAGCTATGGAGATGCGGAGCTCCACTTGGAATTTCCTACTGCTCCTCCTCTTCCCAAAACAGGCACTTCATTTGAAGGCGTTGGCGACATCAGCAAGGGTTACACCTTGGAGCCAATTCGTGCCTTAGCATACGAAGA...

Protein

Download Protein FASTA

621 aa · TkA08G320240|TK1151|PROTEIN

MSSAEVLDHACICRHRAETKLEVKFHHLALRDFINSVIHDFSYGDAELHLEFPTAPPLPKTGTSFEGVGDISKGYTLEPIRALAYEEDQSEDGKSPQLLCFRLEEKHLYPSEFLQNFISILEEDDVMDAADKDSLLNFVGIQETKKKKFNDMILKDIWGGMDYDAIYKESVGQGGETKEKGEAPLLTKELQSFFNDFISNNGLEELKLEGRDFTRSNKSCSKLSKLDRFLISEEVSKDWHNVEVIADQRVISDHCPLILR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G320240`
TK1151 ID	TkA08G320240
OH-1004 ID	LXL04_005358
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	47.000
Protein coverage (%)	TK1151 63.446 / OH-1004 18.538 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G320240`
Location	Chr08:82716098-82718951 (-)
Description	Similar to LINE-1 retrotransposable element ORF2 protein
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005358` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006310 DNA recombination Biological Process GO:0032197 retrotransposition Biological Process GO:0090304 nucleic acid metabolic process Biological Process GO:0003723 RNA binding Molecular Function GO:0003824 catalytic activity Molecular Function GO:0003964 RNA-directed DNA polymerase activity Molecular Function GO:0009036 type II site-specific deoxyribonuclease activity Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.638

Rank 1 · TkA08G320240 · TK1151

Nucleus0.345

Rank 2 · TkA08G320240 · TK1151

Cell membrane0.074

Rank 3 · TkA08G320240 · TK1151

Mitochondrion0.054

Rank 4 · TkA08G320240 · TK1151

Endoplasmic reticulum0.040

Rank 5 · TkA08G320240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28459PET54_N115-128 aa

PF14529Exo_endo_phos_2194-257 aa

PF28459PET54_N270-300 aa

PF14529Exo_endo_phos_2285-339 aa

PF17607DUF5503297-321 aa

PF17607DUF5503425-455 aa

PF00078RVT_1535-620 aa

PF17607DUF5503542-558 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G320240	`PF28459`	PET54_N	115	128	0.15	12.7
TkA08G320240	`PF14529`	Exo_endo_phos_2	194	257	0.16	12.5
TkA08G320240	`PF28459`	PET54_N	270	300	0.15	12.7
TkA08G320240	`PF14529`	Exo_endo_phos_2	285	339	0.16	12.5
TkA08G320240	`PF17607`	DUF5503	297	321	0.0032	18.5
TkA08G320240	`PF17607`	DUF5503	425	455	0.0032	18.5
TkA08G320240	`PF00078`	RVT_1	535	620	2.7e-11	44.4
TkA08G320240	`PF17607`	DUF5503	542	558	0.0032	18.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card