TkA08G304390 | RubberDandelionOmics

Gene overview

TkA08G304390

Reference: TK1151 Chr: Chr08 Coordinates: 78839811-78841814 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1899 bp · TkA08G304390|TK1151|cDNA

ATGTTAGTTGGTTGGAAAACTAACGACTTATTAGACAATGTTCTTGTTAAATTGCTTCCTGAACTACAATTCCTAAGGGTGCTAAGCTTAAGTAATCAGAGAGTCATAGACGTACCAAAATCCATTGGTAATCTCAAGCATCTTCGGTACCTTAATTTCTCTTATACTGAAATCACATGTTTACCGGAACAAGTGTGTGACCTTTATAACCTACAAAGCTTGTTGGTACAGGGTTGTTATGAGTTATCAGGCTTGCCAGA...

CDS

Download CDS FASTA

1899 bp · TkA08G304390|TK1151|CDS

ATGTTAGTTGGTTGGAAAACTAACGACTTATTAGACAATGTTCTTGTTAAATTGCTTCCTGAACTACAATTCCTAAGGGTGCTAAGCTTAAGTAATCAGAGAGTCATAGACGTACCAAAATCCATTGGTAATCTCAAGCATCTTCGGTACCTTAATTTCTCTTATACTGAAATCACATGTTTACCGGAACAAGTGTGTGACCTTTATAACCTACAAAGCTTGTTGGTACAGGGTTGTTATGAGTTATCAGGCTTGCCAGA...

Protein

Download Protein FASTA

632 aa · TkA08G304390|TK1151|PROTEIN

MLVGWKTNDLLDNVLVKLLPELQFLRVLSLSNQRVIDVPKSIGNLKHLRYLNFSYTEITCLPEQVCDLYNLQSLLVQGCYELSGLPESFENVINMRHLDITDTPKLKKMPIGIGGLTSLQTLPKVIITTGANAFKISELKGLSDLQGGLCIMGLEKVINSIQAKDANLHQKKGLEKLEMKWSDMFDDSRNEKIEYEVLEELRPSHHMLRNLKILFCKGTKFPSWVSDPSFDQLTEITLRGCRSTHLPTLGHLRSLKKLVV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G304390`
TK1151 ID	TkA08G304390
OH-1004 ID	LXL04_033741
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	50.700
Protein coverage (%)	TK1151 96.677 / OH-1004 50.387 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G304390

Location Chr08:78839811-78841814 (+)

Description Similar to RPPL1: Putative disease resistance RPP13-like protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g14460`	Potential disease resistance protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033741 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0042742 defense response to bacterium Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0051607 defense response to virus Biological Process

GO:0098542 defense response to other organism Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0004016 adenylate cyclase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0043531 ADP binding Molecular Function

KEGG gene cross-reference

ath:AT3G14460

ath:AT3G14470

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.545

Rank 1 · TkA08G304390 · TK1151

Cytoplasm0.404

Rank 2 · TkA08G304390 · TK1151

Cell membrane0.159

Rank 3 · TkA08G304390 · TK1151

Endoplasmic reticulum0.075

Rank 4 · TkA08G304390 · TK1151

Plastid0.031

Rank 5 · TkA08G304390 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14580LRR_96-73 aa

PF23598LRR_1417-330 aa

PF25019LRR_R13L1-DRL2121-54 aa

PF13516LRR_623-31 aa

PF12799LRR_425-61 aa

PF13855LRR_825-79 aa

PF00560LRR_125-45 aa

PF25013LRR_Zer-142-103 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G304390	`PF14580`	LRR_9	6	73	0.0025	18.1
TkA08G304390	`PF23598`	LRR_14	17	330	8.8e-32	110.9
TkA08G304390	`PF25019`	LRR_R13L1-DRL21	21	54	6e-43	146.5
TkA08G304390	`PF13516`	LRR_6	23	31	0.18	12.6
TkA08G304390	`PF12799`	LRR_4	25	61	1.1e-11	45.3
TkA08G304390	`PF13855`	LRR_8	25	79	2.6e-08	34.2
TkA08G304390	`PF00560`	LRR_1	25	45	0.27	12.2
TkA08G304390	`PF25013`	LRR_Zer-1	42	103	0.00066	20.5
TkA08G304390	`PF23247`	LRR_RPS2	45	104	5.4e-13	49.9
TkA08G304390	`PF13516`	LRR_6	46	59	0.18	12.6
TkA08G304390	`PF00560`	LRR_1	47	67	0.27	12.2
TkA08G304390	`PF23952`	LRR_EndoS	51	122	5.2e-06	27.4
TkA08G304390	`PF25019`	LRR_R13L1-DRL21	67	122	6e-43	146.5
TkA08G304390	`PF12799`	LRR_4	70	108	1.1e-11	45.3
TkA08G304390	`PF00560`	LRR_1	70	91	0.27	12.2
TkA08G304390	`PF13855`	LRR_8	86	122	2.6e-08	34.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LRR5`	Arabidopsis thaliana	sp\|Q9LRR5\|DRL21_ARATH Putative disease resistance protein At3g14460	36.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card