TkA08G302280 | RubberDandelionOmics

Gene overview

TkA08G302280

Reference: TK1151 Chr: Chr08 Coordinates: 78292372-78294210 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

769 bp · TkA08G302280|TK1151|cDNA

ATGGATCAACGCAGTGGAGACCGTCGATTGATTGCGCCTCAGTTTCGATCGATATGTAAAGAACGTAATTGGGAAAATGAAGTCGGCGATCGGTGTGGTTACGTCCTGATGAACCGAAGACACAATGGTGCTGGAAAGAGCACAACAATATCCATGCTTGTTGGCCTTCTTGCTCCTACTTCTGGAGATGCTTTAGTCTTTGGAAAAAGTATCTTAACAGATATGGATGATATAAGGAAGAATTTAGGCGTTTGCCCTCA...

CDS

Download CDS FASTA

408 bp · TkA08G302280|TK1151|CDS

ATGGATCAACGCAGTGGAGACCGTCGATTGATTGCGCCTCAGTTTCGATCGATATGTAAAGAACGTAATTGGGAAAATGAAGTCGGCGATCGGTGTGGTTACGTCCTGATGAACCGAAGACACAATGGTGCTGGAAAGAGCACAACAATATCCATGCTTGTTGGCCTTCTTGCTCCTACTTCTGGAGATGCTTTAGTCTTTGGAAAAAGTATCTTAACAGATATGGATGATATAAGGAAGAATTTAGGCGTTTGCCCTCA...

Protein

Download Protein FASTA

135 aa · TkA08G302280|TK1151|PROTEIN

MDQRSGDRRLIAPQFRSICKERNWENEVGDRCGYVLMNRRHNGAGKSTTISMLVGLLAPTSGDALVFGKSILTDMDDIRKNLGVCPQYDILFQELKVKEHLEIFAHIKGVNEESLENSVTEMVDNVGLTDVLILM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G302280`
TK1151 ID	TkA08G302280
OH-1004 ID	LXL04_036248
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	93.500
Protein coverage (%)	TK1151 68.148 / OH-1004 4.670 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G302280

Location Chr08:78292372-78294210 (-)

Description Similar to ABCA1: ABC transporter A family member 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g41700`	ABC transporter A family member 1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036248 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006855 xenobiotic transmembrane transport Biological Process

GO:0006869 lipid transport Biological Process

GO:0009410 response to xenobiotic stimulus Biological Process

GO:0010875 positive regulation of cholesterol efflux Biological Process

GO:0015914 phospholipid transport Biological Process

GO:0031340 positive regulation of vesicle fusion Biological Process

GO:0032464 positive regulation of protein homooligomerization Biological Process

GO:0042908 xenobiotic transport Biological Process

GO:0043129 surfactant homeostasis Biological Process

GO:0046470 phosphatidylcholine metabolic process Biological Process

GO:0046471 phosphatidylglycerol metabolic process Biological Process

GO:0046618 xenobiotic export from cell Biological Process

KEGG gene cross-reference

ath:AT2G41700

hsa:21

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.335

Rank 1 · TkA08G302280 · TK1151

Peroxisome0.166

Rank 2 · TkA08G302280 · TK1151

Mitochondrion0.148

Rank 3 · TkA08G302280 · TK1151

Nucleus0.135

Rank 4 · TkA08G302280 · TK1151

Extracellular0.109

Rank 5 · TkA08G302280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10163EnY24-58 aa

PF27130Sll1247_N11-87 aa

PF00005ABC_tran41-130 aa

PF10163EnY2111-111 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G302280	`PF10163`	EnY2	4	58	0.25	12.4
TkA08G302280	`PF27130`	Sll1247_N	11	87	0.087	13.1
TkA08G302280	`PF00005`	ABC_tran	41	130	4e-12	47.6
TkA08G302280	`PF10163`	EnY2	111	111	0.25	12.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84M24`	Arabidopsis thaliana	sp\|Q84M24\|AB1A_ARATH ABC transporter A family member 1	71.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card