TkA08G300420 | RubberDandelionOmics

Gene overview

TkA08G300420

Reference: TK1151 Chr: Chr08 Coordinates: 77828705-77832385 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

726 bp · TkA08G300420|TK1151|cDNA

ATGACTGCATCTTTTCTTTGTAATGCATTTGAGTTGTTTTTGTTTTTAATTTATTTTCTTCTGCAGGCACATGCTGCTTCAGCAGTGTTGAATTTCAGTGAGAACTGTACTCCTGATATCTTGACACCTTACTTAGATGGAATAGTGAGCAAACTGCTTGTGTTATTACAGAACGGTAAACAAATGGTTCAAGAAGGGGCCTTGACTGATCTAGCATCAGTTGCTGACTTATCACAGATTCAAAACCCACAAGAAGATTC...

CDS

Download CDS FASTA

726 bp · TkA08G300420|TK1151|CDS

ATGACTGCATCTTTTCTTTGTAATGCATTTGAGTTGTTTTTGTTTTTAATTTATTTTCTTCTGCAGGCACATGCTGCTTCAGCAGTGTTGAATTTCAGTGAGAACTGTACTCCTGATATCTTGACACCTTACTTAGATGGAATAGTGAGCAAACTGCTTGTGTTATTACAGAACGGTAAACAAATGGTTCAAGAAGGGGCCTTGACTGATCTAGCATCAGTTGCTGACTTATCACAGATTCAAAACCCACAAGAAGATTC...

Protein

Download Protein FASTA

241 aa · TkA08G300420|TK1151|PROTEIN

MTASFLCNAFELFLFLIYFLLQAHAASAVLNFSENCTPDILTPYLDGIVSKLLVLLQNGKQMVQEGALTDLASVADLSQIQNPQEDSQRMIAVRKVYQKATVTPTHHVEQHWRDYENFENSVSRALVTFLMQKEGLIFEYQPKYNTARAVYRERKKYVDEIDWNLVAVPPSDFVDLNSLPDLLPDLVYSSSYAKEIRMLCKNGFGQVSTYWMHVSVKNCGFFGLIRTVCRCLLIGFFVGLN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G300420`
TK1151 ID	TkA08G300420
OH-1004 ID	LXL04_019614
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	82.400
Protein coverage (%)	TK1151 30.290 / OH-1004 44.737 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G300420

Location Chr08:77828705-77832385 (+)

Description Similar to IPO5: Importin-5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g17760`	One of the multiple factors required for polyadenylation and 3'-end cleavage of pre-mRNAs (By similarity).	Targeted 3' processing of antisense transcripts triggers Arabidopsis FLC chromatin silencing.2010 · DOI: 10.1126/science.1180278

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019614 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002753 cytoplasmic pattern recognition receptor signaling pathway Biological Process

GO:0006406 mRNA export from nucleus Biological Process

GO:0006606 protein import into nucleus Biological Process

GO:0006607 NLS-bearing protein import into nucleus Biological Process

GO:0006610 ribosomal protein import into nucleus Biological Process

GO:0007088 regulation of mitotic nuclear division Biological Process

GO:0042307 positive regulation of protein import into nucleus Biological Process

GO:0045786 negative regulation of cell cycle Biological Process

GO:0060188 regulation of protein desumoylation Biological Process

GO:0071230 cellular response to amino acid stimulus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005635 nuclear envelope Cellular Component

KEGG gene cross-reference

hsa:26953

hsa:3843

mmu:70572

sce:YMR308C

spo:2539387

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.425

Rank 1 · TkA08G300420 · TK1151

Nucleus0.407

Rank 2 · TkA08G300420 · TK1151

Mitochondrion0.128

Rank 3 · TkA08G300420 · TK1151

Endoplasmic reticulum0.090

Rank 4 · TkA08G300420 · TK1151

Cell membrane0.082

Rank 5 · TkA08G300420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23695YncO9-36 aa

PF13513HEAT_EZ22-72 aa

PF00514Arm47-68 aa

PF05843Suf82-171 aa

PF23695YncO96-113 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G300420	`PF23695`	YncO	9	36	0.28	11.8
TkA08G300420	`PF13513`	HEAT_EZ	22	72	1.1e-05	26.5
TkA08G300420	`PF00514`	Arm	47	68	0.19	12.5
TkA08G300420	`PF05843`	Suf	82	171	2.8e-18	66.5
TkA08G300420	`PF23695`	YncO	96	113	0.28	11.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GUP1`	Arabidopsis thaliana	sp\|Q8GUP1\|CTF77_ARATH Cleavage stimulation factor subunit 77	63.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card