TkA08G295970 | RubberDandelionOmics

Gene overview

TkA08G295970

Reference: TK1151 Chr: Chr08 Coordinates: 76690355-76693673 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2591 bp · TkA08G295970|TK1151|cDNA

ATGGGCACAACGGTTGAAGATATGCATAGGGGCAGCAAGAGGACTCAATTACCTTCACTCAGGCTGGGCTTCAGATTTAGGCCGAATACACAACTCCATACAAAAGTTGCAGGTACCCAGTATTACTTGGATCCCGCTTATCATGAAAGTCACATCCTCCGAAAAGAATCAGACTTATACTCATTTGGGGTGGTACTATTTGAAATGTTGAGTGGGATGTTGGTTTATAGTGAAAGAAGCATCGATGATGGTAGGCCAGA...

CDS

Download CDS FASTA

765 bp · TkA08G295970|TK1151|CDS

ATGGGCACAACGGTTGAAGATATGCATAGGGGCAGCAAGAGGACTCAATTACCTTCACTCAGGCTGGGCTTCAGATTTAGGCCGAATACACAACTCCATACAAAAGTTGCAGGTACCCAGTATTACTTGGATCCCGCTTATCATGAAAGTCACATCCTCCGAAAAGAATCAGACTTATACTCATTTGGGGTGGTACTATTTGAAATGTTGAGTGGGATGTTGGTTTATAGTGAAAGAAGCATCGATGATGGTAGGCCAGA...

Protein

Download Protein FASTA

254 aa · TkA08G295970|TK1151|PROTEIN

MGTTVEDMHRGSKRTQLPSLRLGFRFRPNTQLHTKVAGTQYYLDPAYHESHILRKESDLYSFGVVLFEMLSGMLVYSERSIDDGRPEKLMTFVRGYDPNDLHKLTDPCIRDQIDIRSFDTFSEIAYQCISFNLEERPTMDMVIEKLEEALNIHEIADSTIEFDMEDMVDERTPVFDQVVQSQPEDHGQHNNDKLAYWLSHACTSLFLIQRSLKLQGASSIPKPPPPITPLETYILVFLSFFIFILYIYVPWVQT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G295970`
TK1151 ID	TkA08G295970
OH-1004 ID	LXL04_017530
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	49.400
Protein coverage (%)	TK1151 82.677 / OH-1004 34.161 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G295970

Location Chr08:76690355-76693673 (-)

Description Similar to HERK1: Receptor-like protein kinase HERK 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g72540`	Putative receptor-like protein kinase At1g72540.	No verified direct reference in this release
`At5g47070`	May be involved in plant defense signaling.	No verified direct reference in this release
`At2g19210`	Putative leucine-rich repeat receptor-like protein kinase At2g19210.	No verified direct reference in this release
`At2g28990`	Probable leucine-rich repeat receptor-like protein kinase At2g28990.	No verified direct reference in this release
`At3g46340`	Putative receptor-like protein kinase At3g46340.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017530 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009741 response to brassinosteroid Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0010038 response to metal ion Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

GO:0043680 filiform apparatus Cellular Component

GO:0099503 secretory vesicle Cellular Component

KEGG gene cross-reference

ath:AT2G39360

ath:AT3G46290

ath:AT5G38990

ath:AT5G39000

ath:AT5G59700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.350

Rank 1 · TkA08G295970 · TK1151

Nucleus0.293

Rank 2 · TkA08G295970 · TK1151

Cell membrane0.253

Rank 3 · TkA08G295970 · TK1151

Endoplasmic reticulum0.151

Rank 4 · TkA08G295970 · TK1151

Golgi apparatus0.081

Rank 5 · TkA08G295970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase33-144 aa

PF07714PK_Tyr_Ser-Thr49-146 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G295970	`PF00069`	Pkinase	33	144	8.5e-07	29.3
TkA08G295970	`PF07714`	PK_Tyr_Ser-Thr	49	146	5.4e-05	23.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CAH1`	Arabidopsis thaliana	sp\|Q9CAH1\|Y1725_ARATH Putative receptor-like protein kinase At1g72540	35.200%	Swiss-Prot	Low
`Q9LTC0`	Arabidopsis thaliana	sp\|Q9LTC0\|PBL19_ARATH Probable serine/threonine-protein kinase PBL19	33.100%	Swiss-Prot	Low
`O65924`	Arabidopsis thaliana	sp\|O65924\|Y2921_ARATH Putative leucine-rich repeat receptor-like protein kinase At2g19210	35.000%	Swiss-Prot	Low
`O81069`	Arabidopsis thaliana	sp\|O81069\|Y2899_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g28990	35.000%	Swiss-Prot	Low
`Q9SNA3`	Arabidopsis thaliana	sp\|Q9SNA3\|Y3463_ARATH Putative receptor-like protein kinase At3g46340	33.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card