TkA08G291890 | RubberDandelionOmics

Gene overview

TkA08G291890

Reference: TK1151 Chr: Chr08 Coordinates: 75665420-75665983 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

564 bp · TkA08G291890|TK1151|cDNA

ATGAATTTACTAAACAAGTCCAGTAAAATGACCTTTGGTGACATTGATTTCGGTCCAAATGTTCTTTCAACACCACTTGTTGATAACGCCCAAACAACATTTTATTTTGTCACATTGGAAGCCATTAGTGTCGGAAATAGGCGAATTAAAATACATGACAACTCGAACTCCTCGAAACCGTCGCCAAAAGGAAACATGATTGTGGATTCAGGGACAACATTAACAATGTTACCTCATCGAGTCTACAAGAACGTGGAGAT...

CDS

Download CDS FASTA

564 bp · TkA08G291890|TK1151|CDS

ATGAATTTACTAAACAAGTCCAGTAAAATGACCTTTGGTGACATTGATTTCGGTCCAAATGTTCTTTCAACACCACTTGTTGATAACGCCCAAACAACATTTTATTTTGTCACATTGGAAGCCATTAGTGTCGGAAATAGGCGAATTAAAATACATGACAACTCGAACTCCTCGAAACCGTCGCCAAAAGGAAACATGATTGTGGATTCAGGGACAACATTAACAATGTTACCTCATCGAGTCTACAAGAACGTGGAGAT...

Protein

Download Protein FASTA

187 aa · TkA08G291890|TK1151|PROTEIN

MNLLNKSSKMTFGDIDFGPNVLSTPLVDNAQTTFYFVTLEAISVGNRRIKIHDNSNSSKPSPKGNMIVDSGTTLTMLPHRVYKNVEMAIKDSLNLRTMKDPQKQLNLCYRGTKVKDMPKVIMHFEGADLELTRDNVFVTVSKHIICLAMGTTTDLPILGNLAQMNFKVGFDLEKKMVSFKPTDCEKL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G291890`
TK1151 ID	TkA08G291890
OH-1004 ID	LXL04_033648
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.400
Protein coverage (%)	TK1151 99.465 / OH-1004 41.060 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G291890

Location Chr08:75665420-75665983 (-)

Description Similar to CDR1: Aspartic proteinase CDR1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g33340`	Involved in salicylic acid-dependent inducible resistance responses.	An extracellular aspartic protease functions in Arabidopsis disease resistance signaling.2004 · DOI: 10.1038/sj.emboj.7600086
`At2g35615`	Probable aspartic protease At2g35615.	No verified direct reference in this release
`At4g16563`	Probable aspartyl protease At4g16563.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033648 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010310 regulation of hydrogen peroxide metabolic process Biological Process

GO:0010337 regulation of salicylic acid metabolic process Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004175 endopeptidase activity Molecular Function

GO:0004190 aspartic-type endopeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G01300

ath:AT2G35615

ath:AT5G33340

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.705

Rank 1 · TkA08G291890 · TK1151

Cytoplasm0.088

Rank 2 · TkA08G291890 · TK1151

Endoplasmic reticulum0.086

Rank 3 · TkA08G291890 · TK1151

Lysosome / Vacuole0.085

Rank 4 · TkA08G291890 · TK1151

Cell membrane0.068

Rank 5 · TkA08G291890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00026Asp6-179 aa

PF14541TAXi_C35-180 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G291890	`PF00026`	Asp	6	179	2.3e-10	41.1
TkA08G291890	`PF14541`	TAXi_C	35	180	2e-30	106.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6XBF8`	Arabidopsis thaliana	sp\|Q6XBF8\|CDR1_ARATH Aspartic proteinase CDR1	46.200%	Swiss-Prot	Medium
`Q3EBM5`	Arabidopsis thaliana	sp\|Q3EBM5\|ASPR1_ARATH Probable aspartic protease At2g35615	41.500%	Swiss-Prot	Medium
`Q940R4`	Arabidopsis thaliana	sp\|Q940R4\|ASP63_ARATH Probable aspartyl protease At4g16563	28.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card