TkA08G270230 | RubberDandelionOmics

Gene overview

TkA08G270230

Reference: TK1151 Chr: Chr08 Coordinates: 70400359-70401228 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

774 bp · TkA08G270230|TK1151|cDNA

ATGGCAGAGAGTAAAATAAGGAGGGTTGCTGGTTGTGATGAAGAAGATAGAATCAGTAACTTGCCTGAACATTTGACGGACTCAATCTTAGAGCGACTTCCTATTCAAGATGCAGTAAGGACAAGCATTCTATCAAAAAAGTGGAGGTACAACTGGACCAAAATGAGAGCGTTGCTTTTTGACGAGCATTTTTTAAAAGATTTGAAAAAAAAACCTTTTCGTCGTAATGGTTTTATGAGGATCATAAACAAAGTCTTGAT...

CDS

Download CDS FASTA

774 bp · TkA08G270230|TK1151|CDS

ATGGCAGAGAGTAAAATAAGGAGGGTTGCTGGTTGTGATGAAGAAGATAGAATCAGTAACTTGCCTGAACATTTGACGGACTCAATCTTAGAGCGACTTCCTATTCAAGATGCAGTAAGGACAAGCATTCTATCAAAAAAGTGGAGGTACAACTGGACCAAAATGAGAGCGTTGCTTTTTGACGAGCATTTTTTAAAAGATTTGAAAAAAAAACCTTTTCGTCGTAATGGTTTTATGAGGATCATAAACAAAGTCTTGAT...

Protein

Download Protein FASTA

257 aa · TkA08G270230|TK1151|PROTEIN

MAESKIRRVAGCDEEDRISNLPEHLTDSILERLPIQDAVRTSILSKKWRYNWTKMRALLFDEHFLKDLKKKPFRRNGFMRIINKVLILHMGPISKFVLHIPHVNMALNIFEEFDQWMIILSRNGVKELRPLEFEGFLNLEDLVLMNIVFGDSSSRTQISLPQLKKLSIYECTNVNNFNIKAIKLQCLFVVNYADATLLRLLHSPCLTDVGMYLQNPIQDNIRFLCLFCLENVCRKHLPARMSFWRRERTEALTFAIF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G270230`
TK1151 ID	TkA08G270230
OH-1004 ID	LXL04_033517
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	74.000
Protein coverage (%)	TK1151 86.381 / OH-1004 56.219 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G270230

Location Chr08:70400359-70401228 (-)

Description Similar to At1g13570: F-box/FBD/LRR-repeat protein At1g13570

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g13570`	F-box/FBD/LRR-repeat protein At1g13570.	No verified direct reference in this release
`At2g04230`	F-box/FBD/LRR-repeat protein At2g04230.	No verified direct reference in this release
`At5g44950`	Putative F-box/FBD/LRR-repeat protein At5g44950.	No verified direct reference in this release
`At5g02910`	F-box/LRR-repeat protein At5g02910.	No verified direct reference in this release
`At1g80960`	F-box protein At1g80960.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033517 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source) No functional description available

KEGG gene cross-reference

ath:AT1G13570

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.770

Rank 1 · TkA08G270230 · TK1151

Cytoplasm0.229

Rank 2 · TkA08G270230 · TK1151

Cell membrane0.044

Rank 3 · TkA08G270230 · TK1151

Endoplasmic reticulum0.042

Rank 4 · TkA08G270230 · TK1151

Mitochondrion0.021

Rank 5 · TkA08G270230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box18-54 aa

PF12937F-box-like18-49 aa

PF23952LRR_EndoS108-198 aa

PF12799LRR_4118-146 aa

PF12799LRR_4159-177 aa

PF12799LRR_4216-218 aa

PF12937F-box-like226-235 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G270230	`PF00646`	F-box	18	54	7.5e-08	32.7
TkA08G270230	`PF12937`	F-box-like	18	49	0.0041	17.6
TkA08G270230	`PF23952`	LRR_EndoS	108	198	0.13	13.2
TkA08G270230	`PF12799`	LRR_4	118	146	0.11	13.5
TkA08G270230	`PF12799`	LRR_4	159	177	0.11	13.5
TkA08G270230	`PF12799`	LRR_4	216	218	0.11	13.5
TkA08G270230	`PF12937`	F-box-like	226	235	0.0041	17.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZ70`	Arabidopsis thaliana	sp\|Q9FZ70\|FDL1_ARATH F-box/FBD/LRR-repeat protein At1g13570	44.200%	Swiss-Prot	Low
`Q6NKX3`	Arabidopsis thaliana	sp\|Q6NKX3\|FDL14_ARATH F-box/FBD/LRR-repeat protein At2g04230	40.500%	Swiss-Prot	Low
`Q9FLA2`	Arabidopsis thaliana	sp\|Q9FLA2\|FDL34_ARATH Putative F-box/FBD/LRR-repeat protein At5g44950	27.600%	Swiss-Prot	Low
`Q9LYZ4`	Arabidopsis thaliana	sp\|Q9LYZ4\|FBL79_ARATH F-box/LRR-repeat protein At5g02910	30.700%	Swiss-Prot	Medium
`Q9SAG4`	Arabidopsis thaliana	sp\|Q9SAG4\|FB93_ARATH F-box protein At1g80960	28.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card