TkA08G261500 | RubberDandelionOmics

Gene overview

TkA08G261500

Reference: TK1151 Chr: Chr08 Coordinates: 68181880-68194622 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2090 bp · TkA08G261500|TK1151|cDNA

TTTTACATACACGAAGCTTTCATTCGATAGCTCCATGTGATCCTACTCAATCGCCCTTTCTCGCTCCACCTCGCGAAATACTAACCCTAACCCTTTAACTCGCCAATCAGCCATGGACGACCTTCAAGCAACCTACAAAGAAGACCCTGACGAAGATAATGCCAACACACATAACAACGGTGACGTTAATGCAGAAATGGCGGATCCAAAACCAGAAATTGTCACTTCCACCACCGCCATCACAATCGTCGACGAAGCAC...

CDS

Download CDS FASTA

1092 bp · TkA08G261500|TK1151|CDS

ATGAAAATGGAAGAACATGAAGAACGTCCGACGAAGAAGCATAAGAACCTTTCGTTACTCGCACAGCCAATAGAAGAAGAATTGTCGCTAGAAATTGCTGCAACACCGATCTCGTCGATGCCCCCACCTACTGAAAAACCTAGTGGTAAAAAGTCAACTAGCAGCATGAAGAAGAAAAAGAGCAAGGGCAACAATGTATGGACAAAGCCATCTTCTCGAAAGGGCAAAAAGAGGACTAAGAGCACAACCAGCACCACCGC...

Protein

Download Protein FASTA

363 aa · TkA08G261500|TK1151|PROTEIN

MKMEEHEERPTKKHKNLSLLAQPIEEELSLEIAATPISSMPPPTEKPSGKKSTSSMKKKKSKGNNVWTKPSSRKGKKRTKSTTSTTAQTEDSVLITPIHRYPDKNDDTEDMKICLSKVYKAEKVELSEDRLTAGSCKGYRMVRATRGVMEGAWYFEIKVVNLGETGHTRLGWSTEKGDLQAPVGYDGNSYGYRDIDGSKVHKALREKYGEEGYIEGDVIGFYINLPDGNIYAPKPPQLVLYKGQRYAYSTDAKEDPPKVV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G261500`
TK1151 ID	TkA08G261500
OH-1004 ID	LXL04_033423
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.800
Protein coverage (%)	TK1151 99.449 / OH-1004 75.208 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G261500

Location Chr08:68181880-68194622 (-)

Description Similar to TRO: Protein TRAUCO

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g51450`	Trithorax-group gene homolog required for early embryogenesis.	Arabidopsis COMPASS-like complexes mediate histone H3 lysine-4 trimethylation to control floral transition and plant development.2011 · DOI: 10.1371/journal.pgen.1001330

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033423 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006325 chromatin organization Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006974 DNA damage response Biological Process

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0010557 positive regulation of macromolecule biosynthetic process Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0010629 negative regulation of gene expression Biological Process

GO:0032968 positive regulation of transcription elongation by RNA polymerase II Biological Process

KEGG gene cross-reference

ath:AT1G51450

dme:Dmel_CG6677

hsa:9070

mmu:23808

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.820

Rank 1 · TkA08G261500 · TK1151

Cytoplasm0.225

Rank 2 · TkA08G261500 · TK1151

Cell membrane0.058

Rank 3 · TkA08G261500 · TK1151

Endoplasmic reticulum0.030

Rank 4 · TkA08G261500 · TK1151

Mitochondrion0.016

Rank 5 · TkA08G261500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00622SPRY72-77 aa

PF00622SPRY153-230 aa

PF00622SPRY262-309 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G261500	`PF00622`	SPRY	72	77	4.8e-14	53.2
TkA08G261500	`PF00622`	SPRY	153	230	4.8e-14	53.2
TkA08G261500	`PF00622`	SPRY	262	309	4.8e-14	53.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C8J7`	Arabidopsis thaliana	sp\|Q9C8J7\|TRO_ARATH Protein TRAUCO	74.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card