TkA08G258770 | RubberDandelionOmics

Gene overview

TkA08G258770

Reference: TK1151 Chr: Chr08 Coordinates: 67457264-67459705 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1935 bp · TkA08G258770|TK1151|cDNA

TTTGGGATGGGGTTTTGTTATTGTTGCTGTTGTTGTTATACGACTTGAATCCGGTCCCGTTAAACCACTGCATCCCGGATCTTTAATCACCGGCTGTGGGATTGCGTCAACATGCTCACTATTACTCTCGTAATCCTCTCGATTTTCTCTCTAACAATCCCATCATCTTCTTCCGATCAACAACCCCAACCCCCCGCCGATGTCTGCATCATCGGCACCGGCATGGCCGGCTCATCTGTCGCCCACTTTCTTCGTCAATA...

CDS

Download CDS FASTA

1479 bp · TkA08G258770|TK1151|CDS

ATGCTCACTATTACTCTCGTAATCCTCTCGATTTTCTCTCTAACAATCCCATCATCTTCTTCCGATCAACAACCCCAACCCCCCGCCGATGTCTGCATCATCGGCACCGGCATGGCCGGCTCATCTGTCGCCCACTTTCTTCGTCAATACTCCTCAAGCATATCCCAAATCCGTATGTTCGAGCGTCATCCCATCGTTGGAGGTCGTATGGCAACCGTCACCATCGGCGGAGAAACTTTCGAAGCTGGTGCCTCAATTCT...

Protein

Download Protein FASTA

492 aa · TkA08G258770|TK1151|PROTEIN

MLTITLVILSIFSLTIPSSSSDQQPQPPADVCIIGTGMAGSSVAHFLRQYSSSISQIRMFERHPIVGGRMATVTIGGETFEAGASILHPKNYHALNFTNMLNLKVKGPSASDSSFSLGIWDGQKLLFKTIDSKSKSPVVQYFVSLANSLRMFVRYGISLLKMTNFVEVTVDSFLKYYESKESRPIFKTVEEMLQWADLYNLTTQTLEEELTGLNYSPLLIQELITVITRINYGQSCKISGLAGAVSLAGSGGNLWAVEGG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G258770`
TK1151 ID	TkA08G258770
OH-1004 ID	LXL04_033463
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G258770

Location Chr08:67457264-67459705 (+)

Description Similar to FLCY: Farnesylcysteine lyase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g63910`	Involved in the degradation of prenylcysteine.	Arabidopsis thaliana plants possess a specific farnesylcysteine lyase that is involved in detoxification and recycling of farnesylcysteine.2007 · DOI: 10.1111/j.1365-313x.2007.03091.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033463 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0030327 prenylated protein catabolic process Biological Process

GO:0030328 prenylcysteine catabolic process Biological Process

GO:0045338 farnesyl diphosphate metabolic process Biological Process

GO:1902476 chloride transmembrane transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005764 lysosome Cellular Component

GO:0034361 very-low-density lipoprotein particle Cellular Component

GO:0070062 extracellular exosome Cellular Component

GO:0001735 prenylcysteine oxidase activity Molecular Function

GO:0071949 FAD binding Molecular Function

KEGG gene cross-reference

ath:AT5G63910

hsa:51449

mmu:240334

mmu:66881

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.490

Rank 1 · TkA08G258770 · TK1151

Endoplasmic reticulum0.178

Rank 2 · TkA08G258770 · TK1151

Cytoplasm0.156

Rank 3 · TkA08G258770 · TK1151

Golgi apparatus0.151

Rank 4 · TkA08G258770 · TK1151

Cell membrane0.122

Rank 5 · TkA08G258770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01494FAD_binding_329-50 aa

PF07992Pyr_redox_230-78 aa

PF01266DAO30-67 aa

PF13450NAD_binding_833-94 aa

PF13454NAD_binding_933-70 aa

PF13738Pyr_redox_333-52 aa

PF01593Amino_oxidase60-326 aa

PF07156Prenylcys_lyase144-468 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G258770	`PF01494`	FAD_binding_3	29	50	0.23	11.4
TkA08G258770	`PF07992`	Pyr_redox_2	30	78	0.00037	20.7
TkA08G258770	`PF01266`	DAO	30	67	0.0042	17.4
TkA08G258770	`PF13450`	NAD_binding_8	33	94	1.9e-12	48.0
TkA08G258770	`PF13454`	NAD_binding_9	33	70	0.013	16.2
TkA08G258770	`PF13738`	Pyr_redox_3	33	52	0.25	11.2
TkA08G258770	`PF01593`	Amino_oxidase	60	326	2e-12	47.9
TkA08G258770	`PF07156`	Prenylcys_lyase	144	468	2.8e-104	349.8
TkA08G258770	`PF07992`	Pyr_redox_2	268	311	0.00037	20.7
TkA08G258770	`PF13738`	Pyr_redox_3	268	311	0.25	11.2
TkA08G258770	`PF13454`	NAD_binding_9	270	311	0.013	16.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P57681`	Arabidopsis thaliana	sp\|P57681\|PCYOX_ARATH Farnesylcysteine lyase	62.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card