TkA08G256320 | RubberDandelionOmics

Gene overview

TkA08G256320

Reference: TK1151 Chr: Chr08 Coordinates: 66816049-66819504 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1606 bp · TkA08G256320|TK1151|cDNA

CCCTTTCTCACTTGTGTGGAGGAAAACAGAACTGAAAAACTGTGCGACTGCGAGCACACAGGAACACGAACAAGGAAGAAGAGAAAGATCATCAAGATGGCTCTTCGGATCACTCCGGTGAAGTTGCAATCGGATGGAAACCGTTTTTTTGGTTTTCCTCAAACGGCTAATCTCAGATCTCCCAAATTCGCCATGGCATCCACCCTCGGATCCTCCACCCCGAAAATTGAAACTACAAAAAAACCCTTCACCCCACCAAG...

CDS

Download CDS FASTA

1287 bp · TkA08G256320|TK1151|CDS

CCCTTTCTCACTTGTGTGGAGGAAAACAGAACTGAAAAACTGTGCGACTGCGAGCACACAGGAACACGAACAAGGAAGAAGAGAAAGATCATCAAGATGGCTCTTCGGATCACTCCGGTGAAGTTGCAATCGGATGGAAACCGTTTTTTTGGTTTTCCTCAAACGGCTAATCTCAGATCTCCCAAATTCGCCATGGCATCCACCCTCGGATCCTCCACCCCGAAAATTGAAACTACAAAAAAACCCTTCACCCCACCAAG...

Protein

Download Protein FASTA

428 aa · TkA08G256320|TK1151|PROTEIN

PFLTCVEENRTEKLCDCEHTGTRTRKKRKIIKMALRITPVKLQSDGNRFFGFPQTANLRSPKFAMASTLGSSTPKIETTKKPFTPPREVHLQVTHSMPPQKMEIFKSIEGWAEQNILTHLKPVEKCWQAQDFLPEPSSEGFMDELIEIRARAKEIPDEYFVVLVGDMITEEALPTYQTMLNTLDGVRDETGASPTPWAVWTRAWTAEENRHGDLLHTYLYLSGRVDMRQIQKTIQYLIGSGMDPRTENNPYLGFIYTSFQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G256320`
TK1151 ID	TkA08G256320
OH-1004 ID	LXL04_033383
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 96.963 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G256320`
Location	Chr08:66816049-66819504 (+)
Description	Similar to Stearoyl-[acyl-carrier-protein] 9-desaturase, chloroplastic
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_033383` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006631 fatty acid metabolic process Biological Process GO:0006633 fatty acid biosynthetic process Biological Process GO:0006952 defense response Biological Process GO:0009507 chloroplast Cellular Component GO:0009570 chloroplast stroma Cellular Component GO:0004768 stearoyl-CoA 9-desaturase activity Molecular Function GO:0045300 stearoyl-[ACP] desaturase activity Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	csv:101220831 gmx:547808 rcu:8271760 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.848

Rank 1 · TkA08G256320 · TK1151

Mitochondrion0.142

Rank 2 · TkA08G256320 · TK1151

Cytoplasm0.086

Rank 3 · TkA08G256320 · TK1151

Nucleus0.053

Rank 4 · TkA08G256320 · TK1151

Peroxisome0.032

Rank 5 · TkA08G256320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03405FA_desaturase_2100-422 aa

PF02915Rubrerythrin170-216 aa

PF07618DUF1580183-224 aa

PF02915Rubrerythrin272-309 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G256320	`PF03405`	FA_desaturase_2	100	422	4.9e-159	529.1
TkA08G256320	`PF02915`	Rubrerythrin	170	216	0.0037	18.4
TkA08G256320	`PF07618`	DUF1580	183	224	0.1	12.9
TkA08G256320	`PF02915`	Rubrerythrin	272	309	0.0037	18.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card