Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2257 bp · TkA08G255800|TK1151|cDNA
AATACTTGGTAAAAACCAAATCGTATGTCGATATTTTCTCCCATCATTTTCGTTTTTTTTGCTTCCGACACTTCCAAAATAACGAATCAAGAACAAAAATTGAACACCATGTCTCAATTAAGCCGTCTTCGTCGTCCTTCCTTTTCAGTTTAATGTTCTCCATGAGTCCAACGGAGAATCAGTCGACAGCGATCCCCGTCTAAAACTCTCTTAGCATGATCTTAATCCCCTTTTGTAATCTGGATACACATACATGATAC...
1746 bp · TkA08G255800|TK1151|CDS
ATGAATGCGGAAACGGCTGTAGAGTTTTTGCTGCCTTCATGGTGGGAGGTCCAAGTAACCGTCGCCGCCGCGTTATTTGTAATTGCGGCATACTGGTTCTTCACCGACGGCGGTAACATCGGTGCAGGTGATCGATCTCAGTGTGATAACTCCGCTCTTGTTTCCGGTGATGCCGTAGATGACAAAGAAAAGATAGATCAACAGAAGGGCGACTCTCATGGCACCTCCGCTTACATCATAAAGGTGGAACTGTTAGCAGC...
Protein
Download Protein FASTA581 aa · TkA08G255800|TK1151|PROTEIN
MNAETAVEFLLPSWWEVQVTVAAALFVIAAYWFFTDGGNIGAGDRSQCDNSALVSGDAVDDKEKIDQQKGDSHGTSAYIIKVELLAAKNLIGANLNGMSDPYAIITCGTEKRFSSMVPGSRNPMWGEEFDFSVEELPVKINVSIYDWDIIWKSAVLGSVTIPVENEGHTGAIWHPFNNSPGQVCLNIRTVKHSMNSSRGLKGYVGANPRRRASVYKEGPIVVHQKPGPLQTIFDLLPDEVAQHSYSCAMERSFLYHGRMY...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G255800 |
|---|---|
| TK1151 ID | TkA08G255800 |
| OH-1004 ID | LXL04_033378 |
| Relationship / confidence | Rbh Sequence Supported / Probable |
| Protein identity (%) | 91.300 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G255800 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:66699059-66703155 (-) | |||||||||
| Description | Similar to BAGP1: BAG-associated GRAM protein 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006952 defense response Biological Process GO:0007009 plasma membrane organization Biological Process GO:0050832 defense response to fungus Biological Process GO:0005576 extracellular region Cellular Component GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005886 plasma membrane Cellular Component GO:0016020 membrane Cellular Component GO:0003723 RNA binding Molecular Function GO:0046872 metal ion binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G03370 ath:AT1G63220 ath:AT3G59660 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00168C280-174 aaPF02893GRAM230-296 aaPF26567BstA_C289-360 aaPF02893GRAM325-349 aaPF16016VASt400-546 aaPF26567BstA_C519-553 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G255800 | PF00168 | C2 | 80 | 174 | 1.5e-16 | 61.2 |
| TkA08G255800 | PF02893 | GRAM | 230 | 296 | 1.3e-15 | 57.9 |
| TkA08G255800 | PF26567 | BstA_C | 289 | 360 | 0.028 | 15.3 |
| TkA08G255800 | PF02893 | GRAM | 325 | 349 | 1.3e-15 | 57.9 |
| TkA08G255800 | PF16016 | VASt | 400 | 546 | 2.9e-31 | 109.6 |
| TkA08G255800 | PF26567 | BstA_C | 519 | 553 | 0.028 | 15.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.