TkA08G251070 | RubberDandelionOmics

Gene overview

TkA08G251070

Reference: TK1151 Chr: Chr08 Coordinates: 65572302-65574812 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1966 bp · TkA08G251070|TK1151|cDNA

AGGAAGTAACGGACAACATGTTACTGTCCCTAATCGCATTGGGTCCATTTGGATCTCTAATAAAAGTCGGCCAAAATAAACAAACTCAAACTCGATACACATCTTACCAGGTCTAAGAGGGGTTCTTCTTCTTGGAGCCTCTGTATATATTTTTCTCCACCCTCTTCAGATCTTATAAACCAATATTCCTTCTGTTATTGTCTCTTTCACTTCGTGTTTTTTTCGTGATCAAGTGAAGAACATAGCAGAATCCATAAACA...

CDS

Download CDS FASTA

1644 bp · TkA08G251070|TK1151|CDS

ATGGCTTTATCATCAGTTTGCAATGAAGTCCCATCATTTGCAATATATTCATCTTTCACAAATCCTACGAAAAACAAATCTTTTTCCGACTTGAGAACACCCACCAAGTTTAATTTTGCTTATTCTGACAAACAAACAAAACCCATGAAAATCTTGAAGATGACAAATTTCATGAACCCTAGAACTGATGTAGTTGATCACCCTGCTTTTTATCGGGAAAAGATCAAGAAGATAGAGAGTGAGAAACCAGTTGCGAATTT...

Protein

Download Protein FASTA

547 aa · TkA08G251070|TK1151|PROTEIN

MALSSVCNEVPSFAIYSSFTNPTKNKSFSDLRTPTKFNFAYSDKQTKPMKILKMTNFMNPRTDVVDHPAFYREKIKKIESEKPVANLIGIKEMVNLCGFGYWVQGFRCFPWLALNFHMVNSLHMNPSTLQIVQICAILPMVAKPLYGILSDSIFIGGSHRLPYISIGVMLQVISWGSMAFMPIEALPILMAFILLSNLGASITEVAKDALVVEYGQKNKMKGLQSYAFMALAVGGVLGNCLGGFFLLKTHQPKSMFIIFA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G251070`
TK1151 ID	TkA08G251070
OH-1004 ID	LXL04_033330
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G251070

Location Chr08:65572302-65574812 (+)

Description Similar to At2g33280: Probable folate-biopterin transporter 9, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g04570`	Could mediate folate transport.	No verified direct reference in this release
`At2g33280`	Could mediate folate transport.	No verified direct reference in this release
`At1g64890`	Could mediate folate transport.	No verified direct reference in this release
`At5g54860`	Could mediate folate transport.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033330 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0051958 methotrexate transport Biological Process

GO:0098838 folate transmembrane transport Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0016020 membrane Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0008517 folic acid transmembrane transporter activity Molecular Function

GO:0015231 5-formyltetrahydrofolate transmembrane transporter activity Molecular Function

GO:0015350 methotrexate transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G04570

ath:AT1G64890

ath:AT2G32040

ath:AT2G33280

ath:AT5G54860

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.932

Rank 1 · TkA08G251070 · TK1151

Mitochondrion0.039

Rank 2 · TkA08G251070 · TK1151

Endoplasmic reticulum0.032

Rank 3 · TkA08G251070 · TK1151

Cell membrane0.023

Rank 4 · TkA08G251070 · TK1151

Peroxisome0.021

Rank 5 · TkA08G251070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03092BT1104-515 aa

PF07790Pilin_N347-363 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G251070	`PF03092`	BT1	104	515	3.9e-108	362.7
TkA08G251070	`PF07790`	Pilin_N	347	363	0.014	16.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I5Q2`	Arabidopsis thaliana	sp\|F4I5Q2\|FBT8_ARATH Probable folate-biopterin transporter 8, chloroplastic	59.900%	Swiss-Prot	High
`O22780`	Arabidopsis thaliana	sp\|O22780\|FBT9_ARATH Probable folate-biopterin transporter 9, chloroplastic	55.400%	Swiss-Prot	High
`Q9XIQ7`	Arabidopsis thaliana	sp\|Q9XIQ7\|FBT7_ARATH Probable folate-biopterin transporter 7	42.900%	Swiss-Prot	Medium
`Q8RWQ5`	Arabidopsis thaliana	sp\|Q8RWQ5\|FBT4_ARATH Probable folate-biopterin transporter 4	31.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card