TkA08G250590 | RubberDandelionOmics

Gene overview

TkA08G250590

Reference: TK1151 Chr: Chr08 Coordinates: 65456155-65456577 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

423 bp · TkA08G250590|TK1151|cDNA

ATGTTTCTGTGTATCATCATAGAAGTAGTTGCAGCTGGTGGATGTTTCTGGTCGAATGGGTATTTCATCAATGTTGTCAATGATATCTATCATAGCCCAAACAAAGTTATGGTTCACTGCAAATCAAAAGACAACGATATCGGTGTGAAAACAATTGGATTTAATCAATCTGTCGAGTGGAAATTCTGTGAGAAGATCTGGACTCCGAGTACGCTATTCTTCTGCCATTTTTATATGGGCAATGTTGAACAAGTTTTTGA...

CDS

Download CDS FASTA

423 bp · TkA08G250590|TK1151|CDS

ATGTTTCTGTGTATCATCATAGAAGTAGTTGCAGCTGGTGGATGTTTCTGGTCGAATGGGTATTTCATCAATGTTGTCAATGATATCTATCATAGCCCAAACAAAGTTATGGTTCACTGCAAATCAAAAGACAACGATATCGGTGTGAAAACAATTGGATTTAATCAATCTGTCGAGTGGAAATTCTGTGAGAAGATCTGGACTCCGAGTACGCTATTCTTCTGCCATTTTTATATGGGCAATGTTGAACAAGTTTTTGA...

Protein

Download Protein FASTA

140 aa · TkA08G250590|TK1151|PROTEIN

MFLCIIIEVVAAGGCFWSNGYFINVVNDIYHSPNKVMVHCKSKDNDIGVKTIGFNQSVEWKFCEKIWTPSTLFFCHFYMGNVEQVFDVYNNGIGPQCVERKKEEYWRCTWLIKTDGFYFVDRTSGVRKDVKKYAWKAIRS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G250590`
TK1151 ID	TkA08G250590
OH-1004 ID	LXL04_033319
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 89.744 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G250590

Location Chr08:65456155-65456577 (-)

Description Similar to SPH5: S-protein homolog 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g04645`	S-protein homolog 5.	No verified direct reference in this release
`At3g26880`	S-protein homolog 21.	No verified direct reference in this release
`At5g12060`	S-protein homolog 3.	No verified direct reference in this release
`At5g12070`	S-protein homolog 4.	No verified direct reference in this release
`At4g16195`	S-protein homolog 2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033319 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0060320 rejection of self pollen Biological Process

GO:0005576 extracellular region Cellular Component

KEGG gene cross-reference

ath:AT1G04645

ath:AT3G26880

ath:AT4G24973

ath:AT4G24974

ath:AT5G26060

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.471

Rank 1 · TkA08G250590 · TK1151

Lysosome / Vacuole0.250

Rank 2 · TkA08G250590 · TK1151

Cytoplasm0.156

Rank 3 · TkA08G250590 · TK1151

Cell membrane0.125

Rank 4 · TkA08G250590 · TK1151

Endoplasmic reticulum0.123

Rank 5 · TkA08G250590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05938Self-incomp_S123-135 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G250590	`PF05938`	Self-incomp_S1	23	135	2.7e-23	83.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23020`	Arabidopsis thaliana	sp\|O23020\|SPH5_ARATH S-protein homolog 5	33.300%	Swiss-Prot	Medium
`Q9LW22`	Arabidopsis thaliana	sp\|Q9LW22\|SPH21_ARATH S-protein homolog 21	31.600%	Swiss-Prot	Medium
`Q9FMQ4`	Arabidopsis thaliana	sp\|Q9FMQ4\|SPH3_ARATH S-protein homolog 3	33.300%	Swiss-Prot	Medium
`F4JZG1`	Arabidopsis thaliana	sp\|F4JZG1\|SPH4_ARATH S-protein homolog 4	32.000%	Swiss-Prot	Medium
`F4JLQ5`	Arabidopsis thaliana	sp\|F4JLQ5\|SPH2_ARATH S-protein homolog 2	32.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card