TkA08G249140 | RubberDandelionOmics

Gene overview

TkA08G249140

Reference: TK1151 Chr: Chr08 Coordinates: 65064621-65068452 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1314 bp · TkA08G249140|TK1151|cDNA

GGATATTTTTATCGCCGTGGGTCCCGCTTTCCCGACGGTTTGCGGCTTAAAATAGTATTATTTTTGGAAAAGGGTAGGTTGGTAAATGCCACTACGATGAAATTTGGGCCTAAAATCGAAATCCACACTTGACAACCACCACCACCACCGACGACGACGACGAGTGCCAGAGCTGCAATTCTTGTCGTCCTCCGGCTCACCTATTAGTTGCATTCTCCGAGATGTTGATATGCAGACTCTGAATTAGGAAAAAGAAAGTC...

CDS

Download CDS FASTA

618 bp · TkA08G249140|TK1151|CDS

ATGTTTTCATTGTTTTATGGACTTTGGAAATATCTTGTTAGTAAGACAGAGTTTCATGTACTGATTCTTGGAATCGACAAGGCTGGAAAAACAACCTTACTTGAGAAACTGAAGACACAATATTCAAGTTTAGAAGGCCTGCCCCCTGACCGAATAGTTCCTACAGTTGGACTCAATATTGGTCGAATAGAAACTTCAAATTCAAAACTTGTGTTTTGGGACCTTGGAGGTCAGTCTGGTCTTCGGTCAATTTGGGAGAA...

Protein

Download Protein FASTA

205 aa · TkA08G249140|TK1151|PROTEIN

MFSLFYGLWKYLVSKTEFHVLILGIDKAGKTTLLEKLKTQYSSLEGLPPDRIVPTVGLNIGRIETSNSKLVFWDLGGQSGLRSIWEKYYEEAHAVIFVVDASCPSRFEESKSALEKVLRHEDLQGAPLLILANKQDLADAVTSEELGQYLDLKKLDERAYAFEAVSGYDGTGIKETVNWLVDVMERSKRTEMLRVRAGVANGSGA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G249140`
TK1151 ID	TkA08G249140
OH-1004 ID	LXL04_033296
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G249140`
Location	Chr08:65064621-65068452 (-)
Description	Similar to Arfrp1: ADP-ribosylation factor-related protein 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_033296` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006886 intracellular protein transport Biological Process GO:0007165 signal transduction Biological Process GO:0034067 protein localization to Golgi apparatus Biological Process GO:0042147 retrograde transport, endosome to Golgi Biological Process GO:0043001 Golgi to plasma membrane protein transport Biological Process GO:0005794 Golgi apparatus Cellular Component GO:0005802 trans-Golgi network Cellular Component GO:0005829 cytosol Cellular Component GO:0016020 membrane Cellular Component GO:0032588 trans-Golgi network membrane Cellular Component GO:0003924 GTPase activity Molecular Function GO:0005525 GTP binding Molecular Function
KEGG gene cross-reference	bta:525394 hsa:10139 mmu:76688 pon:100444340 rno:117051 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.453

Rank 1 · TkA08G249140 · TK1151

Cytoplasm0.357

Rank 2 · TkA08G249140 · TK1151

Endoplasmic reticulum0.194

Rank 3 · TkA08G249140 · TK1151

Lysosome / Vacuole0.165

Rank 4 · TkA08G249140 · TK1151

Cell membrane0.142

Rank 5 · TkA08G249140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00025Arf12-182 aa

PF00503G-alpha15-42 aa

PF20720nSTAND316-46 aa

PF01580FtsK_SpoIIIE17-37 aa

PF09439SRPRB19-147 aa

PF13401AAA_2219-143 aa

PF02421FeoB_N19-102 aa

PF00071Ras20-182 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G249140	`PF00025`	Arf	12	182	3.6e-50	170.5
TkA08G249140	`PF00503`	G-alpha	15	42	2.1e-12	47.5
TkA08G249140	`PF20720`	nSTAND3	16	46	0.15	12.4
TkA08G249140	`PF01580`	FtsK_SpoIIIE	17	37	0.17	12.0
TkA08G249140	`PF09439`	SRPRB	19	147	2.5e-07	31.0
TkA08G249140	`PF13401`	AAA_22	19	143	0.0059	17.6
TkA08G249140	`PF02421`	FeoB_N	19	102	0.3	11.3
TkA08G249140	`PF00071`	Ras	20	182	2.5e-11	44.1
TkA08G249140	`PF08477`	Roc	20	136	2.6e-11	44.5
TkA08G249140	`PF01926`	MMR_HSR1	20	134	1.3e-07	32.5
TkA08G249140	`PF00009`	GTP_EFTU	20	40	1.2e-05	25.7
TkA08G249140	`PF04670`	Gtr1_RagA	20	145	7.6e-05	23.0
TkA08G249140	`PF00350`	Dynamin_N	20	37	0.27	12.0
TkA08G249140	`PF19993`	DO-GTPase2	22	35	0.22	11.9
TkA08G249140	`PF03029`	ATP_bind_1	23	40	0.023	15.2
TkA08G249140	`PF02223`	Thymidylate_kin	24	42	0.046	14.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card