TkA08G248950 | RubberDandelionOmics

Gene overview

TkA08G248950

Reference: TK1151 Chr: Chr08 Coordinates: 65020486-65023231 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1119 bp · TkA08G248950|TK1151|cDNA

AAAACATTATGGAAACTCTTCAAAATCAAGGGAAACTTACCTTTCAACCACTTCCTTCCAGATTCCAATCCATAACTGATTGTTTTGTTATTCTGCGAAACCAAAAAACCCGACCCGACTCATCTCGCATTCCCCAATCTCCACGCACCAACACCGAGCTCACATAATCGCAGGGGCAAAGGATCTGTACGGGGGATCTGTCTGATATCATTCTTCCAAGCAGATCTGTTCGAGTTTTTGACGATTGATCTCATTTCTTC...

CDS

Download CDS FASTA

648 bp · TkA08G248950|TK1151|CDS

ATGAATATATTCAGACTTGCAGGGGACATGACGCATTTGGCGAGTGTCCTTGTGTTACTGCTCAAGATCCACACCATCAAATCATGCGCTGGTGTATCATTGAAAACTCAGGAACTGTATGCACTGGTCTTTGCTACACGCTACTTGGACATAGTTACTGATTTTATCTCAGTATACAATACTGTGATGAAGTTAATCTTTCTAGGGAGTTCCTTCTCTATTGTATGGTACATAAGGCGCCATAGGGTTGTTAGAAGATC...

Protein

Download Protein FASTA

215 aa · TkA08G248950|TK1151|PROTEIN

MNIFRLAGDMTHLASVLVLLLKIHTIKSCAGVSLKTQELYALVFATRYLDIVTDFISVYNTVMKLIFLGSSFSIVWYIRRHRVVRRSYDKDQDTFRHYLLMIPCLLLALLVHEKFTFKEVMWTFSLYLEAVAILPQLVLLQRTRNIDNLTGQYIFLLGAYRALYILNWIYRYFTEPHFVHWITWIAGVVQTLLYADFFYYYFESWKNNVRLQLPA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G248950`
TK1151 ID	TkA08G248950
OH-1004 ID	LXL04_033288
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G248950

Location Chr08:65020486-65023231 (+)

Description Similar to ERD2B: ER lumen protein-retaining receptor B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g25040`	Determines the specificity of the luminal endoplasmic reticulum protein retention system.	Specific ER quality control components required for biogenesis of the plant innate immune receptor EFR.2009 · DOI: 10.1073/pnas.0905532106
`At1g29330`	Required for the retention of luminal endoplasmic reticulum proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033288 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006621 protein retention in ER lumen Biological Process

GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum Biological Process

GO:0015031 protein transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005801 cis-Golgi network Cellular Component

GO:0016020 membrane Cellular Component

GO:0030663 COPI-coated vesicle membrane Cellular Component

KEGG gene cross-reference

ath:AT1G29330

ath:AT3G25040

dme:Dmel_CG5183

dre:373129

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.489

Rank 1 · TkA08G248950 · TK1151

Golgi apparatus0.479

Rank 2 · TkA08G248950 · TK1151

Cytoplasm0.170

Rank 3 · TkA08G248950 · TK1151

Cell membrane0.081

Rank 4 · TkA08G248950 · TK1151

Nucleus0.067

Rank 5 · TkA08G248950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04193PQ-loop21-48 aa

PF00810ER_lumen_recept28-171 aa

PF04193PQ-loop63-78 aa

PF04193PQ-loop120-173 aa

PF00810ER_lumen_recept189-204 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G248950	`PF04193`	PQ-loop	21	48	0.019	15.4
TkA08G248950	`PF00810`	ER_lumen_recept	28	171	1.2e-58	198.7
TkA08G248950	`PF04193`	PQ-loop	63	78	0.019	15.4
TkA08G248950	`PF04193`	PQ-loop	120	173	0.019	15.4
TkA08G248950	`PF00810`	ER_lumen_recept	189	204	1.2e-58	198.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VWI1`	Arabidopsis thaliana	sp\|Q8VWI1\|ERD2B_ARATH ER lumen protein-retaining receptor B	85.600%	Swiss-Prot	High
`P35402`	Arabidopsis thaliana	sp\|P35402\|ERD2A_ARATH ER lumen protein-retaining receptor A	68.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card