Gene Card
Gene overview
cDNA / CDS / Protein Sequences
602 bp · TkA08G247550|TK1151|cDNA
ATTCTCAAGTCATTATCCAACAAATTTGGAGGGATATTACGATTTTGCCATTCAAGAAACAGATATGAAAGGTTAGACAATAAGCTCGAAATTAAAATGAAGGAGGTCAAAGTCAAACAAAGCAGTACATCTGGAAAGAGCAATATCAGATCTATAAATAGCATAATTCTCAGGTTTCCTCATTTCAGAGAGGGATTGCAAGAGGTTAGGGATGTTTTTCGACAGTACGATACTGATGCTAATGGAACTATCAACCGCGA...
480 bp · TkA08G247550|TK1151|CDS
ATTCTCAAGTCATTATCCAACAAATTTGGAGGGATATTACGATTTTGCCATTCAAGAAACAGATATGAAAGGTTAGACAATAAGCTCGAAATTAAAATGAAGGAGGTCAAAGTCAAACAAAGCAGTACATCTGGAAAGAGCAATATCAGATCTATAAATAGCATAATTCTCAGGTTTCCTCATTTCAGAGAGGGATTGCAAGAGGTTAGGGATGTTTTTCGACAGTACGATACTGATGCTAATGGAACTATCAACCGCGA...
Protein
Download Protein FASTA159 aa · TkA08G247550|TK1151|PROTEIN
ILKSLSNKFGGILRFCHSRNRYERLDNKLEIKMKEVKVKQSSTSGKSNIRSINSIILRFPHFREGLQEVRDVFRQYDTDANGTINREELKKCLQELQLDCTEQEIDDLFESCDLTGKKGMKFNEFVVVLCLVYLLVDTSSSHHTATKLVRLCSKQHLIP
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G247550 |
|---|---|
| TK1151 ID | TkA08G247550 |
| OH-1004 ID | LXL04_033273 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 99.100 |
| Protein coverage (%) | TK1151 72.956 / OH-1004 60.417Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G247550 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:64692435-64693553 (+) | |||||||||
| Description | No functional description available | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006970 response to osmotic stress Biological Process GO:0009612 response to mechanical stimulus Biological Process GO:0009646 response to absence of light Biological Process GO:0009652 thigmotropism Biological Process GO:0010152 pollen maturation Biological Process GO:0035556 intracellular signal transduction Biological Process GO:0051301 cell division Biological Process GO:0071456 cellular response to hypoxia Biological Process GO:1902584 positive regulation of response to water deprivation Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT2G41100 ath:AT3G24110 ath:AT4G26470 dosa:Os03g0688300 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF08976EF-hand_1123-34 aaPF08889WbqC32-108 aaPF25578EF-hand_STIM163-95 aaPF21008AIF-164-128 aaPF13833EF-hand_867-95 aaPF13499EF-hand_768-126 aaPF13405EF-hand_668-96 aaPF00036EF-hand_168-95 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G247550 | PF08976 | EF-hand_11 | 23 | 34 | 0.027 | 16.1 |
| TkA08G247550 | PF08889 | WbqC | 32 | 108 | 0.021 | 15.4 |
| TkA08G247550 | PF25578 | EF-hand_STIM1 | 63 | 95 | 0.013 | 16.2 |
| TkA08G247550 | PF21008 | AIF-1 | 64 | 128 | 0.14 | 13.1 |
| TkA08G247550 | PF13833 | EF-hand_8 | 67 | 95 | 3.4e-07 | 30.6 |
| TkA08G247550 | PF13499 | EF-hand_7 | 68 | 126 | 5.9e-11 | 43.3 |
| TkA08G247550 | PF13405 | EF-hand_6 | 68 | 96 | 4.5e-09 | 36.0 |
| TkA08G247550 | PF00036 | EF-hand_1 | 68 | 95 | 6.2e-09 | 35.5 |
| TkA08G247550 | PF23564 | EF-hand_FSTL1 | 68 | 97 | 0.003 | 18.7 |
| TkA08G247550 | PF12763 | EH | 69 | 143 | 0.0032 | 18.1 |
| TkA08G247550 | PF13202 | EF-hand_5 | 70 | 93 | 6.8e-07 | 29.2 |
| TkA08G247550 | PF08976 | EF-hand_11 | 71 | 129 | 0.027 | 16.1 |
| TkA08G247550 | PF10591 | SPARC_Ca_bdg | 72 | 126 | 9.5e-05 | 23.4 |
| TkA08G247550 | PF14658 | EF-hand_9 | 72 | 130 | 0.00086 | 20.4 |
| TkA08G247550 | PF13833 | EF-hand_8 | 82 | 129 | 3.4e-07 | 30.6 |
| TkA08G247550 | PF08418 | Pol_alpha_B_N | 87 | 118 | 1.1 | 9.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.