TkA08G242480 | RubberDandelionOmics

Gene overview

TkA08G242480

Reference: TK1151 Chr: Chr08 Coordinates: 63301412-63304750 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1618 bp · TkA08G242480|TK1151|cDNA

AAATGGGGTTATTTTGATATTTGACTTTTCAAAATTACCCTTGTAATACCGATTTTAACCTAACACAGCGAACGACTCTGAGTCCTTACGTCCTTACACCTCGCACGCTCCTCCACCCCGACATTCCTGCTCCAGCGACCCCGAAGTTCCTGCTCCAGCTACGCCGGCGACTGCCCTTCCTGCCGACGACAGCGATTTCCTCCGGCGAAGCCTCCCCAGCAGCTCATTTCGGTAAAAACTGGCTATTTAAGGCGTACGGT...

CDS

Download CDS FASTA

660 bp · TkA08G242480|TK1151|CDS

ATGTGCAATGGAAAGAACATTCTTGTATCATGGTCGTATGTGATTATTCCTTTTGGAGATATAGATGAGATACGAAGGAGTCAACATGCAGTCATTAATCCAGCAATAACAATCGTCCTTCGGTTAGGTGCAGGAGGACATGGCGCTCCCCCTTTGCGAAGTCCAGATGGTAGAGTTAGATATATGTTTGCCTCATTTTGGAACAGAAATCATGCAGTGAGAACTTTACAACGTTCAGCAAAGAATTACCATTCCATGAT...

Protein

Download Protein FASTA

219 aa · TkA08G242480|TK1151|PROTEIN

MCNGKNILVSWSYVIIPFGDIDEIRRSQHAVINPAITIVLRLGAGGHGAPPLRSPDGRVRYMFASFWNRNHAVRTLQRSAKNYHSMIEAEKKEEQQSELRASSSSLNRKKTVKVLEESVPSKHQPFIHEDVLTEIYNVIDPTHHEEAVMGGSMTAILNTNGDFCAIQKAGGEGVLQSVIMQCLRIASVKADDITTKIKTAGVSGFLIFSKWNRITQKEH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G242480`
TK1151 ID	TkA08G242480
OH-1004 ID	LXL04_033378
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	76.100
Protein coverage (%)	TK1151 66.667 / OH-1004 29.680 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G242480

Location Chr08:63301412-63304750 (-)

Description Similar to BAGP1: BAG-associated GRAM protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g59660`	Involved in proteolytic processing of BAG6.	Aspartyl Protease-Mediated Cleavage of BAG6 Is Necessary for Autophagy and Fungal Resistance in Plants.2016 · DOI: 10.1105/tpc.15.00626
`At3g12990`	Probable 3'->5' exoribonuclease involved in the regulation of cuticular wax biosynthesis.	A core subunit of the RNA-processing/degrading exosome specifically influences cuticular wax biosynthesis in Arabidopsis.2007 · DOI: 10.1105/tpc.106.049304
`At3g60500`	Probable 3'->5' exoribonuclease involved in the regulation of cuticular wax biosynthesis by controlling the expression of CER3.	A core subunit of the RNA-processing/degrading exosome specifically influences cuticular wax biosynthesis in Arabidopsis.2007 · DOI: 10.1105/tpc.106.049304 RDR1 and SGS3, components of RNA-mediated gene silencing, are required for the regulation of cuticular wax biosynthesis in developing inflorescence stems of Arabidopsis.2012 · DOI: 10.1104/pp.112.199646

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033378 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007009 plasma membrane organization Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G03370

ath:AT1G63220

ath:AT3G59660

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.336

Rank 1 · TkA08G242480 · TK1151

Cell membrane0.300

Rank 2 · TkA08G242480 · TK1151

Nucleus0.243

Rank 3 · TkA08G242480 · TK1151

Endoplasmic reticulum0.187

Rank 4 · TkA08G242480 · TK1151

Golgi apparatus0.158

Rank 5 · TkA08G242480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03725RNase_PH_C137-187 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G242480	`PF03725`	RNase_PH_C	137	187	2.5e-09	37.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W4D4`	Arabidopsis thaliana	sp\|Q8W4D4\|BAGP1_ARATH BAG-associated GRAM protein 1	57.200%	Swiss-Prot	Medium
`Q9LDM2`	Arabidopsis thaliana	sp\|Q9LDM2\|CER7L_ARATH Exosome complex component RRP45A	60.300%	Swiss-Prot	Low
`Q9M209`	Arabidopsis thaliana	sp\|Q9M209\|CER7_ARATH Exosome complex component RRP45B	65.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card