Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1859 bp · TkA08G240370|TK1151|cDNA
AAAAAAGGGATGTTACAGTGCATGCAGGCCTACTATATAAATAAGAGCACGATACCGTTTTTTCTTGATACATCATAATTAGACACTTTCTTACATATCATATCTGAATCGCATTTTGTCTTCTATTTTTCAATGACAAATTCTCTCATATATACCCCTAGCTTATTTTCTTCGAATACCGCCACGGCCACGGCCACCACCACCACCACCACCGCAATCCTTTCTTATTTCAAAACCTCAATCTCCCGTCCTCATAAATC...
1368 bp · TkA08G240370|TK1151|CDS
ATGACAAATTCTCTCATATATACCCCTAGCTTATTTTCTTCGAATACCGCCACGGCCACGGCCACCACCACCACCACCACCGCAATCCTTTCTTATTTCAAAACCTCAATCTCCCGTCCTCATAAATCAGCTACAATTCTGTGTTGCAACCGTCCAAACTACATCCCTAACCATATTCAAAACCCTAACCGTATCCGAATCTTTGATACGACTTTACGTGATGGTGAACAAGCCCCTGGTGCATCAATGACCCCTAAGCA...
Protein
Download Protein FASTA455 aa · TkA08G240370|TK1151|PROTEIN
MTNSLIYTPSLFSSNTATATATTTTTTAILSYFKTSISRPHKSATILCCNRPNYIPNHIQNPNRIRIFDTTLRDGEQAPGASMTPKQKLDIAHQLAKLGVDIIEVGFPASNKADLETVKLIACEVGNVAVNDDGRIPVICGLARCHKNDIDKAWEAVQYAKFPRIHIFIATSEIHMKYKLKMSKEEVIEKARSMVAYARSLGCNDVQFSPEDAGRSDKEFLYEVLSEAVKAGATTLCIPDTVGYNWPREFGQLIADIKTN...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G240370 |
|---|---|
| TK1151 ID | TkA08G240370 |
| OH-1004 ID | LXL04_033197 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.100 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G240370 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:62681830-62688195 (-) | |||||||||
| Description | Similar to IPMSA: 2-isopropylmalate synthase A | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0009098 L-leucine biosynthetic process Biological Process GO:0009877 nodulation Biological Process GO:0019761 glucosinolate biosynthetic process Biological Process GO:0009507 chloroplast Cellular Component GO:0009570 chloroplast stroma Cellular Component GO:0009941 chloroplast envelope Cellular Component GO:0003852 2-isopropylmalate synthase activity Molecular Function GO:0010177 methylthioalkylmalate synthase activity Molecular Function GO:0016829 lyase activity Molecular Function GO:0046872 metal ion binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G18500 ath:AT1G74040 gmx:547778 spen:107023302 spen:107028537 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00682HMGL-like64-344 aaPF18993Rv0078B82-103 aaPF22615IPMS_D2207-220 aaPF22617HCS_D2275-321 aaPF22617HCS_D2358-442 aaPF22615IPMS_D2364-391 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G240370 | PF00682 | HMGL-like | 64 | 344 | 2.4e-92 | 309.7 |
| TkA08G240370 | PF18993 | Rv0078B | 82 | 103 | 0.2 | 12.1 |
| TkA08G240370 | PF22615 | IPMS_D2 | 207 | 220 | 0.018 | 16.1 |
| TkA08G240370 | PF22617 | HCS_D2 | 275 | 321 | 3.4e-28 | 98.6 |
| TkA08G240370 | PF22617 | HCS_D2 | 358 | 442 | 3.4e-28 | 98.6 |
| TkA08G240370 | PF22615 | IPMS_D2 | 364 | 391 | 0.018 | 16.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.