RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G233670
Reference: TK1151 Chr: Chr08 Coordinates: 60899285-60901675 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1440 bp · TkA08G233670|TK1151|cDNA

ATGGCTCTAGTCCAACTGTGTCTCATCTTTCTAACTATTTACCTACGTCTCATAGCTGCACAACAAACTAATGGTTCCATATTTGTTGGCTCGTCACTAACCGCGACACCTAGCGTCAAACCATGGCTTTCATCTTCCGGTGAATTTGCCTTTGGGTTCAAACAAGTTGAAGGAAGCGATGACTTTTTGTTGTCAATTTGGTATGACAAGATACCTGACAAGACCATCATCTGTAATCCACAAGGCAGAGAGATATGGAC...

CDS

Download CDS FASTA

1440 bp · TkA08G233670|TK1151|CDS

ATGGCTCTAGTCCAACTGTGTCTCATCTTTCTAACTATTTACCTACGTCTCATAGCTGCACAACAAACTAATGGTTCCATATTTGTTGGCTCGTCACTAACCGCGACACCTAGCGTCAAACCATGGCTTTCATCTTCCGGTGAATTTGCCTTTGGGTTCAAACAAGTTGAAGGAAGCGATGACTTTTTGTTGTCAATTTGGTATGACAAGATACCTGACAAGACCATCATCTGTAATCCACAAGGCAGAGAGATATGGAC...

Protein

Download Protein FASTA

479 aa · TkA08G233670|TK1151|PROTEIN

MALVQLCLIFLTIYLRLIAAQQTNGSIFVGSSLTATPSVKPWLSSSGEFAFGFKQVEGSDDFLLSIWYDKIPDKTIICNPQGREIWTSGPISDLEFGLVNDTGNFVIVGSNSRKIWDSFDFPADTLLPTQLMVSGGVINSKQSNLNYSGGRFQLRLIPGTCVFVIVVLTVAVCVGFFVIYKKKANYRDPRSKAIESNLAHFTYQELDEATNGFKDELGSGAFGIVYKGVIGKHMVAVKMLNRMVQDGEKEFKAEVDSIAR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G233670
TK1151 IDTkA08G233670
OH-1004 IDLXL04_033129
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)58.900
Protein coverage (%)TK1151 97.286 / OH-1004 83.923
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G233670
LocationChr08:60899285-60901675 (-)
DescriptionSimilar to LECRK3: G-type lectin S-receptor-like serine/threonine-protein kinase LECRK3
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g60900 G-type lectin S-receptor-like serine/threonine-protein kinase RLK1. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os04g0201900 Involved in innate immunity. No verified direct reference in this release
UniProt: A0A075F7E9 Involved in innate immunity. No verified direct reference in this release
UniProt: Q25AG3 Involved in resistance against the herbivorous insect brown planthopper (N.lugens, BPH). No verified direct reference in this release
UniProt: A2XQD3 Involved in resistance against the herbivorous insect brown planthopper (N.lugens, BPH). No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_033129 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006952 defense response Biological Process
GO:0051707 response to other organism Biological Process
GO:0016020 membrane Cellular Component
GO:0004672 protein kinase activity Molecular Function
GO:0004674 protein serine/threonine kinase activity Molecular Function
GO:0005524 ATP binding Molecular Function
GO:0030246 carbohydrate binding Molecular Function
GO:0106310 protein serine kinase activity Molecular Function
KEGG gene cross-reference
dosa:Os04g0201900
dosa:Os04g0202350
dosa:Os04g0202500
osa:9266608
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.806
Rank 1 · TkA08G233670 · TK1151
Endoplasmic reticulum0.111
Rank 2 · TkA08G233670 · TK1151
Cytoplasm0.078
Rank 3 · TkA08G233670 · TK1151
Lysosome / Vacuole0.046
Rank 4 · TkA08G233670 · TK1151
Nucleus0.042
Rank 5 · TkA08G233670 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01453B_lectin78-132 aa
PF25630Phycodna_minor_capsid161-205 aa
PF04584Pox_A28162-187 aa
PF07714PK_Tyr_Ser-Thr213-283 aa
PF00069Pkinase214-282 aa
PF03109ABC1218-246 aa
PF14531Kinase-like279-383 aa
PF07714PK_Tyr_Ser-Thr284-458 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G233670PF01453B_lectin781325.3e-0627.6
TkA08G233670PF25630Phycodna_minor_capsid1612050.02615.6
TkA08G233670PF04584Pox_A281621870.09113.7
TkA08G233670PF07714PK_Tyr_Ser-Thr2132832.5e-35122.8
TkA08G233670PF00069Pkinase2142821.1e-38133.8
TkA08G233670PF03109ABC12182460.002317.9
TkA08G233670PF14531Kinase-like2793830.01815.0
TkA08G233670PF07714PK_Tyr_Ser-Thr2844582.5e-35122.8
TkA08G233670PF00069Pkinase2884571.1e-38133.8
TkA08G233670PF07387Seadorna_VP72883320.112.3
TkA08G233670PF01636APH2973230.09213.2
TkA08G233670PF03109ABC12983400.002317.9
TkA08G233670PF17667Pkinase_fungal3053740.0612.8
TkA08G233670PF25630Phycodna_minor_capsid3854420.02615.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q39202Arabidopsis thalianasp|Q39202|RLK1_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase RLK151.000%Swiss-ProtMedium
Q7FAZ3Oryza sativa subsp. japonicasp|Q7FAZ3|LERK1_ORYSJ G-type lectin S-receptor-like serine/threonine-protein kinase LECRK146.200%Swiss-ProtMedium
A0A075F7E9Oryza sativa subsp. indicasp|A0A075F7E9|LERK1_ORYSI G-type lectin S-receptor-like serine/threonine-protein kinase LECRK145.500%Swiss-ProtMedium
Q25AG3Oryza sativa subsp. indicasp|Q25AG3|LERK3_ORYSI G-type lectin S-receptor-like serine/threonine-protein kinase LECRK348.900%Swiss-ProtMedium
A2XQD3Oryza sativa subsp. indicasp|A2XQD3|LERK2_ORYSI G-type lectin S-receptor-like serine/threonine-protein kinase LECRK249.300%Swiss-ProtMedium

JBrowse

View in Genome Browser