TkA08G228280 | RubberDandelionOmics

Gene overview

TkA08G228280

Reference: TK1151 Chr: Chr08 Coordinates: 59464335-59465928 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

906 bp · TkA08G228280|TK1151|cDNA

GCACTTAAAATATGTAAAGGCATCAATAATGGAGTCTTCTACATTGTGGTTCTTCTACCACTACCTTCCATAAATACCACCTATTCACCACATACACCACCACACTCCACTCAAAAAACCATCATCACTTCTCTCGACCTCGAAGCCATGACGAAGGATGTTGAAGTGGCTGAGCACCACGGTGGCGCCGGCGAATACGGCGCCAAGGACTACCACGATCCACCTCCCGCCCCCTTCTTCGACGCTGAAGAACTCACCAA...

CDS

Download CDS FASTA

1017 bp · TkA08G228280|TK1151|CDS

GCACTTAAAATATGTAAAGGCATCAATAATGGAGTCTTCTACATTGTGGTTCTTCTACCACTACCTTCCATAAATACCACCTATTCACCACATACACCACCACACTCCACTCAAAAAACCATCATCACTTCTCTCGACCTCGAAGCCATGACGAAGGATGTTGAAGTGGCTGAGCACCACGGTGGCGCCGGCGAATACGGCGCCAAGGACTACCACGATCCACCTCCCGCCCCCTTCTTCGACGCTGAAGAACTCACCAA...

Protein

Download Protein FASTA

338 aa · TkA08G228280|TK1151|PROTEIN

ALKICKGINNGVFYIVVLLPLPSINTTYSPHTPPHSTQKTIITSLDLEAMTKDVEVAEHHGGAGEYGAKDYHDPPPAPFFDAEELTKWSFYRALIAEFVATLLFLYITVLTVIGYKVQTDPALDTDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVGYMIAQCLGAICGVGLVKAFQSSYYDRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G228280`
TK1151 ID	TkA08G228280
OH-1004 ID	LXL04_033063
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 92.012 / OH-1004 74.940 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G228280

Location Chr08:59464335-59465928 (+)

Description Similar to PIP2-2: Aquaporin PIP2-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g37170`	Water channel required to facilitate the transport of water across cell membrane.	No verified direct reference in this release
`At5g60660`	Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.	No verified direct reference in this release
`At2g37180`	Water channel required to facilitate the transport of water across cell membrane; mercury-insensitive.	The plasma membrane of Arabidopsis thaliana contains a mercury-insensitive aquaporin that is a homolog of the tonoplast water channel protein TIP.1994 · DOI: 10.1104/pp.106.4.1325

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0629200`	Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033063 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006833 water transport Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0048767 root hair elongation Biological Process

GO:0080170 hydrogen peroxide transmembrane transport Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0015250 water channel activity Molecular Function

KEGG gene cross-reference

ath:AT2G37170

ath:AT5G60660

dosa:Os02g0629200

zma:541889

zma:541890

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.554

Rank 1 · TkA08G228280 · TK1151

Lysosome / Vacuole0.195

Rank 2 · TkA08G228280 · TK1151

Endoplasmic reticulum0.175

Rank 3 · TkA08G228280 · TK1151

Cytoplasm0.112

Rank 4 · TkA08G228280 · TK1151

Golgi apparatus0.071

Rank 5 · TkA08G228280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00230MIP84-319 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G228280	`PF00230`	MIP	84	319	4.2e-84	282.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P43287`	Arabidopsis thaliana	sp\|P43287\|PIP22_ARATH Aquaporin PIP2-2	84.100%	Swiss-Prot	High
`Q9FF53`	Arabidopsis thaliana	sp\|Q9FF53\|PIP24_ARATH Probable aquaporin PIP2-4	83.500%	Swiss-Prot	High
`P30302`	Arabidopsis thaliana	sp\|P30302\|PIP23_ARATH Aquaporin PIP2-3	82.700%	Swiss-Prot	High
`Q6K215`	Oryza sativa subsp. japonica	sp\|Q6K215\|PIP22_ORYSJ Probable aquaporin PIP2-2	82.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card