TkA08G223110 | RubberDandelionOmics

Gene overview

TkA08G223110

Reference: TK1151 Chr: Chr08 Coordinates: 58238651-58239987 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

546 bp · TkA08G223110|TK1151|cDNA

ATGATTAGATTACAGAGCTCATTATTCAATACTTTTCGTTCTAAATCGATCGCATTTCGGAGGCTATCAGTTTTTAGGGCGACGAGTTCGAAGAAGTATTCACCAAAAATGGCACCTCCAATTTTTTCTTTAGCTTTACCATCGGAAACCGGTCGGGTTCTCAGTATTCAATCTCACACTGTTCAGGGTTATGTTGGCAATAAGTCGGCTGTCTTTCCACTTCAACTACTGGGTTATGATGTGGATCCAATTATGTCAGT...

CDS

Download CDS FASTA

546 bp · TkA08G223110|TK1151|CDS

ATGATTAGATTACAGAGCTCATTATTCAATACTTTTCGTTCTAAATCGATCGCATTTCGGAGGCTATCAGTTTTTAGGGCGACGAGTTCGAAGAAGTATTCACCAAAAATGGCACCTCCAATTTTTTCTTTAGCTTTACCATCGGAAACCGGTCGGGTTCTCAGTATTCAATCTCACACTGTTCAGGGTTATGTTGGCAATAAGTCGGCTGTCTTTCCACTTCAACTACTGGGTTATGATGTGGATCCAATTATGTCAGT...

Protein

Download Protein FASTA

181 aa · TkA08G223110|TK1151|PROTEIN

MIRLQSSLFNTFRSKSIAFRRLSVFRATSSKKYSPKMAPPIFSLALPSETGRVLSIQSHTVQGYVGNKSAVFPLQLLGYDVDPIMSVQFSNHTGYPTFRGQVLNGKQLWELIEGLEANNLLYYTHLSTCYFGSVSFLDNVLEVVKKLRSINPSLTYVCDPVMGDEGKLYVPQELVFVYRCS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G223110`
TK1151 ID	TkA08G223110
OH-1004 ID	LXL04_006996
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.100
Protein coverage (%)	TK1151 98.895 / OH-1004 52.035 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G223110

Location Chr08:58238651-58239987 (+)

Description Similar to PK: Pyridoxal kinase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g37850`	Catalyzes the transfer of a phosphate group from ATP to the 5-hydroxylmethyl group of pyridoxal to form the biologically active pyridoxal phosphate, an active form of vitamin B6.	The Arabidopsis salt overly sensitive 4 mutants uncover a critical role for vitamin B6 in plant salt tolerance.2002 · DOI: 10.1105/tpc.010417 SOS4, a pyridoxal kinase gene, is required for root hair development in Arabidopsis.2002 · DOI: 10.1104/pp.001982

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006996 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008615 pyridoxine biosynthetic process Biological Process

GO:0009443 pyridoxal 5'-phosphate salvage Biological Process

GO:0010054 trichoblast differentiation Biological Process

GO:0042538 hyperosmotic salinity response Biological Process

GO:0042816 vitamin B6 metabolic process Biological Process

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT5G37850

bta:514168

mmu:216134

oas:443049

ssc:396983

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.417

Rank 1 · TkA08G223110 · TK1151

Mitochondrion0.264

Rank 2 · TkA08G223110 · TK1151

Cytoplasm0.256

Rank 3 · TkA08G223110 · TK1151

Peroxisome0.140

Rank 4 · TkA08G223110 · TK1151

Nucleus0.091

Rank 5 · TkA08G223110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W1X2`	Arabidopsis thaliana	sp\|Q8W1X2\|PDXK_ARATH Pyridoxal kinase	84.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card