TkA08G218720 | RubberDandelionOmics

Gene overview

TkA08G218720

Reference: TK1151 Chr: Chr08 Coordinates: 57155636-57163035 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

855 bp · TkA08G218720|TK1151|cDNA

GCGACAACTAAAACCAACCAATCAGATCACGTCTGTGAATCCATATATAAACAAAACCCTCCATTTTTACTCTCAACATCAACAAGAAGCAATTCACCACTTTCCCTCTTTACCAAACACAAATTCACTACAATGGCGCCAAAGGCAGAAAAGAAGCCAGCTGAGAAGAAGCCGTCAGAGGAGAAGAAATCCGCCGTGGCCGAAAAAGCCCCCGCCGAGAAGAAGCCAAAGGCCGGGAAGAAGCTCCCCAAGGAAGCCGG...

CDS

Download CDS FASTA

579 bp · TkA08G218720|TK1151|CDS

GCGACAACTAAAACCAACCAATCAGATCACGTCTGTGAATCCATATATAAACAAAACCCTCCATTTTTACTCTCAACATCAACAAGAAGCAATTCACCACTTTCCCTCTTTACCAAACACAAATTCACTACAATGGCGCCAAAGGCAGAAAAGAAGCCAGCTGAGAAGAAGCCGTCAGAGGAGAAGAAATCCGCCGTGGCCGAAAAAGCCCCCGCCGAGAAGAAGCCAAAGGCCGGGAAGAAGCTCCCCAAGGAAGCCGG...

Protein

Download Protein FASTA

192 aa · TkA08G218720|TK1151|PROTEIN

ATTKTNQSDHVCESIYKQNPPFLLSTSTRSNSPLSLFTKHKFTTMAPKAEKKPAEKKPSEEKKSAVAEKAPAEKKPKAGKKLPKEAGAGAVDKKKKRSKKNVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G218720`
TK1151 ID	TkA08G218720
OH-1004 ID	LXL04_032993
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 76.562 / OH-1004 99.324 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G218720

Location Chr08:57155636-57163035 (-)

Description Similar to Probable histone H2B.1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g46030`	Core component of nucleosome.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032993 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006325 chromatin organization Biological Process

GO:0000786 nucleosome Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0030527 structural constituent of chromatin Molecular Function

GO:0046982 protein heterodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT2G28720

ath:AT3G45980

mtr:11417139

mtr:11442767

mtr:25492748

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.925

Rank 1 · TkA08G218720 · TK1151

Cytoplasm0.117

Rank 2 · TkA08G218720 · TK1151

Extracellular0.019

Rank 3 · TkA08G218720 · TK1151

Mitochondrion0.018

Rank 4 · TkA08G218720 · TK1151

Cell membrane0.017

Rank 5 · TkA08G218720 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27648HIR3_C34-102 aa

PF00125Histone92-168 aa

PF00808CBFD_NFYB_HMF110-166 aa

PF03847TFIID_20kDa111-164 aa

PF26281Histone_ABTB122-190 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G218720	`PF27648`	HIR3_C	34	102	3.2	8.4
TkA08G218720	`PF00125`	Histone	92	168	2.4e-20	73.4
TkA08G218720	`PF00808`	CBFD_NFYB_HMF	110	166	0.00017	22.5
TkA08G218720	`PF03847`	TFIID_20kDa	111	164	0.036	15.2
TkA08G218720	`PF26281`	Histone_ABTB	122	190	1.1e-07	32.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZT0`	Arabidopsis thaliana	sp\|Q9LZT0\|H2B7_ARATH Histone H2B.7	91.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card