TkA08G212110 | RubberDandelionOmics

Gene overview

TkA08G212110

Reference: TK1151 Chr: Chr08 Coordinates: 55510954-55512621 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1313 bp · TkA08G212110|TK1151|cDNA

TTGTGATTACCGCAAATGAAAACCAACCCCAGCAACCAGAAGACTGTGGAGTCACCGTCTTACACAGCGTTGTGCGCACGGGAATACGCAAACCAGTGGACGAACGAAAATGGCGACGGAGAATCGGAATCCAGAAATCAGGAAAGACTCAGTCAACAACAGGCTGGTGATTCTATCACCGGCTCGATCTCGCCGGCCGTCGGACTTCAAATCCAAATCCCAAGCCAAATCCGACTCAAGCCCGAGCTCCAACGCCCAAC...

CDS

Download CDS FASTA

609 bp · TkA08G212110|TK1151|CDS

ATGGCGACGGAGAATCGGAATCCAGAAATCAGGAAAGACTCAGTCAACAACAGGCTGGTGATTCTATCACCGGCTCGATCTCGCCGGCCGTCGGACTTCAAATCCAAATCCCAAGCCAAATCCGACTCAAGCCCGAGCTCCAACGCCCAACCACAGTGTCCGTTTTGTGCCGGAAACGAGCACCAATGCGCACCGGAAATTTTCCGGTTTCCTGAAGATTCTACTTCCGATTGGAAGGTCCGAGTGATCGAAAACTTGTA...

Protein

Download Protein FASTA

202 aa · TkA08G212110|TK1151|PROTEIN

MATENRNPEIRKDSVNNRLVILSPARSRRPSDFKSKSQAKSDSSPSSNAQPQCPFCAGNEHQCAPEIFRFPEDSTSDWKVRVIENLYPALSRELQVKSNHEEYCQATGTAVEVSLGGFGFHDVIIESPIHSVHLPDLSPAGVAVVLLAYKKRIEQLCAVDSISYIQVFKNHGATAGASMSHSHSQILALPVIPTTASIVSTP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G212110`
TK1151 ID	TkA08G212110
OH-1004 ID	LXL04_032894
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 97.525 / OH-1004 51.436 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G212110

Location Chr08:55510954-55512621 (-)

Description Similar to At5g18200: ADP-glucose phosphorylase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g18200`	Catalyzes the conversion of ADP-glucose and inorganic phosphate (Pi) into glucose-1-phosphate and ADP.	Structure and mechanism of an ADP-glucose phosphorylase from Arabidopsis thaliana.2006 · DOI: 10.1021/bi052232m

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032894 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006006 glucose metabolic process Biological Process

GO:0006012 galactose metabolic process Biological Process

GO:0033499 galactose catabolic process via UDP-galactose, Leloir pathway Biological Process

GO:0052574 UDP-galactose biosynthetic process Biological Process

GO:0080040 positive regulation of cellular response to phosphate starvation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004335 galactokinase activity Molecular Function

GO:0008108 UDP-glucose:hexose-1-phosphate uridylyltransferase activity Molecular Function

GO:0008198 ferrous iron binding Molecular Function

KEGG gene cross-reference

ath:AT5G18200

ecj:JW0741

eco:b0758

ecoc:C3026_03845

hin:HI_0820

spo:2541407

tma:TM1191

tmi:THEMA_08375

tmm:Tmari_1198

tmw:THMA_1217

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.519

Rank 1 · TkA08G212110 · TK1151

Nucleus0.383

Rank 2 · TkA08G212110 · TK1151

Mitochondrion0.209

Rank 3 · TkA08G212110 · TK1151

Peroxisome0.076

Rank 4 · TkA08G212110 · TK1151

Plastid0.051

Rank 5 · TkA08G212110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01087GalP_UDP_transf7-193 aa

PF16268DUF492124-80 aa

PF16285DUF4931_N47-59 aa

PF19327Ap4A_phos_N73-87 aa

PF16285DUF4931_N122-189 aa

PF01230HIT124-187 aa

PF16268DUF4921161-189 aa

PF19327Ap4A_phos_N167-197 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G212110	`PF01087`	GalP_UDP_transf	7	193	1.2e-16	62.4
TkA08G212110	`PF16268`	DUF4921	24	80	2e-06	27.7
TkA08G212110	`PF16285`	DUF4931_N	47	59	2.7e-05	25.0
TkA08G212110	`PF19327`	Ap4A_phos_N	73	87	0.00056	20.2
TkA08G212110	`PF16285`	DUF4931_N	122	189	2.7e-05	25.0
TkA08G212110	`PF01230`	HIT	124	187	0.037	15.4
TkA08G212110	`PF16268`	DUF4921	161	189	2e-06	27.7
TkA08G212110	`PF19327`	Ap4A_phos_N	167	197	0.00056	20.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FK51`	Arabidopsis thaliana	sp\|Q9FK51\|AGLUP_ARATH ADP-glucose phosphorylase	59.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card