TkA08G206520 | RubberDandelionOmics

Gene overview

TkA08G206520

Reference: TK1151 Chr: Chr08 Coordinates: 53957413-53960352 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

801 bp · TkA08G206520|TK1151|cDNA

ATGGGGATCCAGGGACGTTTGCCTCTAATGAAATCGGTTATGGTTCCTATCCACATAAAGGATCTCGAAGGTTATTCAGTTGACGTAGATACTTACTCTTGGCTCCATAAGGGAGCTCTTTCTTGCAGCATGGAGCTCTACAAATCCCAACCTACTTCCAAGTACACATCTTTCTTGTGTTCCCAATACATTGGGAAACAAATAACTCCATCAGGTTCATCCTTCACGACGTCTTCCTCTATTGCTTCAAGAATCGCTAA...

CDS

Download CDS FASTA

801 bp · TkA08G206520|TK1151|CDS

ATGGGGATCCAGGGACGTTTGCCTCTAATGAAATCGGTTATGGTTCCTATCCACATAAAGGATCTCGAAGGTTATTCAGTTGACGTAGATACTTACTCTTGGCTCCATAAGGGAGCTCTTTCTTGCAGCATGGAGCTCTACAAATCCCAACCTACTTCCAAGTACACATCTTTCTTGTGTTCCCAATACATTGGGAAACAAATAACTCCATCAGGTTCATCCTTCACGACGTCTTCCTCTATTGCTTCAAGAATCGCTAA...

Protein

Download Protein FASTA

266 aa · TkA08G206520|TK1151|PROTEIN

MGIQGRLPLMKSVMVPIHIKDLEGYSVDVDTYSWLHKGALSCSMELYKSQPTSKYTSFLCSQYIGKQITPSGSSFTTSSSIASRIANLFLAGISSFYYALIKSSPFQSDSNSLDSFTINGVTEIQCLPLPSYAATPRTRLQQLLSIANGSVFLLFWFVDFAITSMVLTLIDKPLRPPKNGVPAFEDDLRRFWDRRFMDTLSVKDYEFWLHCLSPKEVAAAISFPLSQVEVVDKASDFNPFEETPAPAPKPNTNCSAPVKP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G206520`
TK1151 ID	TkA08G206520
OH-1004 ID	LXL04_032815
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 53.383 / OH-1004 97.931 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G206520

Location Chr08:53957413-53960352 (-)

Description Similar to EXO1: Exonuclease 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g29630`	Putative 5'->3' double-stranded DNA exonuclease which may also contain a cryptic 3'->5' double-stranded DNA exonuclease activity.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0777300`	Putative 5'->3' double-stranded DNA exonuclease which may also contain a cryptic 3'->5' double-stranded DNA exonuclease activity.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032815 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002376 immune system process Biological Process

GO:0006281 DNA repair Biological Process

GO:0006298 mismatch repair Biological Process

GO:0006310 DNA recombination Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0090656 t-circle formation Biological Process

GO:0110025 DNA strand resection involved in replication fork processing Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0016604 nuclear body Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003682 chromatin binding Molecular Function

KEGG gene cross-reference

ath:AT1G29630

dosa:Os01g0777300

hsa:9156

xla:399140

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.347

Rank 1 · TkA08G206520 · TK1151

Nucleus0.339

Rank 2 · TkA08G206520 · TK1151

Mitochondrion0.145

Rank 3 · TkA08G206520 · TK1151

Endoplasmic reticulum0.116

Rank 4 · TkA08G206520 · TK1151

Plastid0.089

Rank 5 · TkA08G206520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00752XPG_N1-64 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G206520	`PF00752`	XPG_N	1	64	2.3e-06	28.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L6Z7`	Arabidopsis thaliana	sp\|Q8L6Z7\|EXO1_ARATH Exonuclease 1	70.700%	Swiss-Prot	Low
`Q60GC1`	Oryza sativa subsp. japonica	sp\|Q60GC1\|EXO1_ORYSJ Exonuclease 1	56.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card