RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G206450
Reference: TK1151 Chr: Chr08 Coordinates: 53934433-53937229 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2714 bp · TkA08G206450|TK1151|cDNA

CCTTGTTTAAGATTTAGAAATACAAAAGGGGAAATGGTATGAAAGAGAGTGCAACCACGCGTGGAAAAAGTAGGCAAATCGAAAGATGCCTCGACAGAGATTTTTTCACGCTTATCAAAAGGTTATGTGAACAAGTAAATAAAGCTCCAAAAGCCATACTCTTGCCTGGACTCGAGCCCAGAATGTTTGCTTTTAATTCTTACAGGTATCTTGGTTTCCCCTCTTACCTGAAAGATGAAAACCCTCGTCTTCTTTTCTTA...

CDS

Download CDS FASTA

2070 bp · TkA08G206450|TK1151|CDS

ATGTCTGTCCAATCCGCGTCATTTATCAGGAATCTCGTCTGTAAATCGATGGAACCAAGATGGGATTTCTGTTTGAGGACTTGTCGAATCTTTAATTCAAGGTTTACGCCGCTGTTTCTGCTGTTTTTCCTTTCGTTTTCGATGATTTCTTCTTCTGTTGCTAACGAAGATGAAGTATTCGACGAAATTACTCTCGACTTACAAGACAGAGCTTCACTTGTGCTGTTCAAGTCACAGCTCCATGACCCGACGCAGAGATT...

Protein

Download Protein FASTA

689 aa · TkA08G206450|TK1151|PROTEIN

MSVQSASFIRNLVCKSMEPRWDFCLRTCRIFNSRFTPLFLLFFLSFSMISSSVANEDEVFDEITLDLQDRASLVLFKSQLHDPTQRLSWVGSSCTNWTGVGCSRWNGRVLALNLTGFNLSGQLHPSLCKLSFLETLYLSRNSLSGQIPACFSSLWSIKILDLSYNMLSGVIPNTLVKLSRLTQLDFSHNLFDQMLPYWIGNFSLKLEKIEMGFNSFRGEIPESLLQLKSLKYLGLSHNKFSGNLPDFRQALEHLSLESNS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G206450
TK1151 IDTkA08G206450
OH-1004 IDLXL04_032813
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)100.000
Protein coverage (%)TK1151 98.839 / OH-1004 64.795
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G206450
LocationChr08:53934433-53937229 (+)
DescriptionSimilar to CLV2: Receptor-like protein CLAVATA2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g65380 Involved in the perception of CLV3 and CLV3-like (CLE) peptides, that act as extracellular signals regulating meristems maintenance.
The Arabidopsis CLAVATA2 gene encodes a receptor-like protein required for the stability of the CLAVATA1 receptor-like kinase.1999 · DOI: 10.1105/tpc.11.10.1925
The 14-amino acid CLV3, CLE19, and CLE40 peptides trigger consumption of the root meristem in Arabidopsis through a CLAVATA2-dependent pathway.2005 · DOI: 10.1105/tpc.105.034009
Functional analyses of the CLAVATA2-like proteins and their domains that contribute to CLAVATA2 specificity.2010 · DOI: 10.1104/pp.109.148197
Stem cell signaling in Arabidopsis requires CRN to localize CLV2 to the plasma membrane.2010 · DOI: 10.1104/pp.109.149930
CLE14/CLE20 peptides may interact with CLAVATA2/CORYNE receptor-like kinases to irreversibly inhibit cell division in the root meristem of Arabidopsis.2010 · DOI: 10.1007/s00425-010-1236-4
Nematode CLE signaling in Arabidopsis requires CLAVATA2 and CORYNE.2011 · DOI: 10.1111/j.1365-313x.2010.04433.x
Mechanisms of molecular mimicry of plant CLE peptide ligands by the parasitic nematode Globodera rostochiensis.2011 · DOI: 10.1104/pp.111.180554
Perception of root-active CLE peptides requires CORYNE function in the phloem vasculature.2017 · DOI: 10.15252/embr.201643535
CLAVATA2, a regulator of meristem and organ development in Arabidopsis.1998 · DOI: 10.1242/dev.125.19.3843

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_032813 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0007165 signal transduction Biological Process
GO:0009653 anatomical structure morphogenesis Biological Process
GO:0009742 brassinosteroid mediated signaling pathway Biological Process
GO:0009908 flower development Biological Process
GO:0009909 regulation of flower development Biological Process
GO:0010075 regulation of meristem growth Biological Process
GO:0010078 maintenance of root meristem identity Biological Process
GO:0010088 phloem development Biological Process
GO:0030154 cell differentiation Biological Process
GO:0040008 regulation of growth Biological Process
GO:0045595 regulation of cell differentiation Biological Process
GO:0048507 meristem development Biological Process
KEGG gene cross-reference
ath:AT1G65380
dosa:Os04g0576900
osa:4336741
zma:542675
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.774
Rank 1 · TkA08G206450 · TK1151
Endoplasmic reticulum0.121
Rank 2 · TkA08G206450 · TK1151
Cytoplasm0.070
Rank 3 · TkA08G206450 · TK1151
Nucleus0.060
Rank 4 · TkA08G206450 · TK1151
Lysosome / Vacuole0.039
Rank 5 · TkA08G206450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_268-103 aa
PF23598LRR_14108-309 aa
PF00560LRR_1112-130 aa
PF12799LRR_4113-144 aa
PF24141LRR_ComC118-174 aa
PF13516LRR_6131-144 aa
PF00560LRR_1133-154 aa
PF13855LRR_8133-190 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G206450PF08263LRRNT_2681031.8e-0525.6
TkA08G206450PF23598LRR_141083092.3e-2073.4
TkA08G206450PF00560LRR_11121301.5e-62194.6
TkA08G206450PF12799LRR_41131441.4e-40137.1
TkA08G206450PF24141LRR_ComC1181744.8e-0937.0
TkA08G206450PF13516LRR_61311443.6e-1039.8
TkA08G206450PF00560LRR_11331541.5e-62194.6
TkA08G206450PF13855LRR_81331902.3e-48162.5
TkA08G206450PF29460LRR_NXF21361681.59.3
TkA08G206450PF24048LRR_NXF1-51551810.09313.1
TkA08G206450PF00560LRR_11561781.5e-62194.6
TkA08G206450PF12799LRR_41571911.4e-40137.1
TkA08G206450PF13516LRR_61571653.6e-1039.8
TkA08G206450PF23952LRR_EndoS1601891.310.0
TkA08G206450PF11479Suppressor_P211641930.1313.2
TkA08G206450PF25013LRR_Zer-11731880.0315.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
O80809Arabidopsis thalianasp|O80809|CLV2_ARATH Receptor-like protein CLAVATA254.100%Swiss-ProtLow

JBrowse

View in Genome Browser