TkA08G206410 | RubberDandelionOmics

Gene overview

TkA08G206410

Reference: TK1151 Chr: Chr08 Coordinates: 53926188-53926938 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

465 bp · TkA08G206410|TK1151|cDNA

ATGGCTGAACTTCTACTTCTACTTCCTCTGTTTCCTGGAGAAAGCGGTGTTGATCAATTAGTTGTTTATATAATAGGTTTTGGGAACACCCACAAGAGTGGAGTAAAGTGTATGAATCCAAATTACACTGAGTTCAGGTTCCCTCAAATAAAGCCTCATCCATGGCACAAGATTTTTCAGAAACGATTACCTCCTGAAGCAGTGAATCTTGTTTGTAGATTTTTCCAGTATTCACCCAATTTTACGTTGAAAAAATTGGA...

CDS

Download CDS FASTA

369 bp · TkA08G206410|TK1151|CDS

ATGGCTGAACTTCTACTTCTACTTCCTCTGTTTCCTGGAGAAAGCGGTGTTGATCAATTAGTTGTTTATATAATAGGTTTTGGGAACACCCACAAGAGTGGAGTAAAGTGTATGAATCCAAATTACACTGAGTTCAGGTTCCCTCAAATAAAGCCTCATCCATGGCACAAGATTTTTCAGAAACGATTACCTCCTGAAGCAGTGAATCTTGTTTGTAGATTTTTCCAGTATTCACCCAATTTTACGTTGAAAAAATTGGA...

Protein

Download Protein FASTA

122 aa · TkA08G206410|TK1151|PROTEIN

MAELLLLLPLFPGESGVDQLVVYIIGFGNTHKSGVKCMNPNYTEFRFPQIKPHPWHKIFQKRLPPEAVNLVCRFFQYSPNFTLKKLEACVHPFFDELRDPAPVPFLQSLILNPRYVYVTFMP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G206410`
TK1151 ID	TkA08G206410
OH-1004 ID	LXL04_032812
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	82.900
Protein coverage (%)	TK1151 86.885 / OH-1004 63.953 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G206410

Location Chr08:53926188-53926938 (+)

Description Similar to ASK4: Shaggy-related protein kinase delta

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g57870`	May mediate extracellular signals to regulate transcription in differentiating cells.	No verified direct reference in this release
`At1g09840`	May mediate extracellular signals to regulate transcription in differentiating cells.	No verified direct reference in this release
`At4g00720`	May mediate extracellular signals to regulate transcription in differentiating cells.	No verified direct reference in this release
`At3g05840`	May mediate extracellular signals to regulate transcription in differentiating cells.	No verified direct reference in this release
`At5g14640`	May mediate extracellular signals to regulate transcription in differentiating cells.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032812 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006972 hyperosmotic response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0030154 cell differentiation Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G09840

ath:AT1G57870

ath:AT4G00720

ath:AT5G14640

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.493

Rank 1 · TkA08G206410 · TK1151

Nucleus0.345

Rank 2 · TkA08G206410 · TK1151

Mitochondrion0.128

Rank 3 · TkA08G206410 · TK1151

Endoplasmic reticulum0.095

Rank 4 · TkA08G206410 · TK1151

Cell membrane0.063

Rank 5 · TkA08G206410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FVS6`	Arabidopsis thaliana	sp\|Q9FVS6\|KSG4_ARATH Shaggy-related protein kinase delta	75.000%	Swiss-Prot	High
`Q39019`	Arabidopsis thaliana	sp\|Q39019\|KSG10_ARATH Shaggy-related protein kinase kappa	75.000%	Swiss-Prot	High
`Q96287`	Arabidopsis thaliana	sp\|Q96287\|KSG8_ARATH Shaggy-related protein kinase theta	69.000%	Swiss-Prot	High
`P43289`	Arabidopsis thaliana	sp\|P43289\|KSG3_ARATH Shaggy-related protein kinase gamma	69.000%	Swiss-Prot	High
`Q8VZD5`	Arabidopsis thaliana	sp\|Q8VZD5\|KSG5_ARATH Shaggy-related protein kinase epsilon	70.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card