Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3964 bp · TkA08G205040|TK1151|cDNA
CAAATTTCCCTCATCTTCTGCAGAACACCCAAACACACCCCTCACCCCTTCTTCGATGCTCAGAAGAGAAGAAGCGCGAGCGCCTTGGTCCTTCTTGTACACACTTTCAGGCCCTATCAGCCCACCATTGCCATCTCTTCTTCTCTACTCATTACCTTCAACGCTCGCTTTCTCTCTAGGTATTAACGGTGGTGACTGGTGACTTCTGATCGGACGGCCCTCCTCTCGTGAGAATCATGACCATGATGACTCCACAACCG...
3387 bp · TkA08G205040|TK1151|CDS
ATGACCATGATGACTCCACAACCGTTAGATCAAGAAGATGAAGAAATGCTTGTTCCACATACAGAACTAGTGGAAGGTCCTCTTGCTTTGGATGGTACTCCACCTGTTGTAGGCCCTCAACCTATGGAAGTCATGGGTCCAGCAGAAGTTGTTAGCACTGCAGAGAATCAACCAGCTGATGAAACTCAGGCATCTAGGTTTACATGGGTAATTGATAATTTCTCACGTCAAAGTAACAAAAAGATTTATTCAGATACTTT...
Protein
Download Protein FASTA1128 aa · TkA08G205040|TK1151|PROTEIN
MTMMTPQPLDQEDEEMLVPHTELVEGPLALDGTPPVVGPQPMEVMGPAEVVSTAENQPADETQASRFTWVIDNFSRQSNKKIYSDTFVVGGFKWRVLIFPKGNNVDNLSMYLDVADSSTLPYGWSRYAQFSLAVVNQIHTKFTMRKDTQHQFHGRESDWGFTSFMPLVDLYDPSKGFLVNDTCIIEADVAVRKVIDYWSYDSKKETGYVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTENDMPTGSIPLALQSLF...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G205040 |
|---|---|
| TK1151 ID | TkA08G205040 |
| OH-1004 ID | LXL04_032793 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.900 |
| Protein coverage (%) | TK1151 98.670 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G205040 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:53574527-53581707 (+) | |||||||||
| Description | Similar to UBP12: Ubiquitin carboxyl-terminal hydrolase 12 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000045 autophagosome assembly Biological Process GO:0006283 transcription-coupled nucleotide-excision repair Biological Process GO:0006307 DNA alkylation repair Biological Process GO:0006508 proteolysis Biological Process GO:0009867 jasmonic acid mediated signaling pathway Biological Process GO:0010078 maintenance of root meristem identity Biological Process GO:0010507 negative regulation of autophagy Biological Process GO:0010508 positive regulation of autophagy Biological Process GO:0010803 regulation of tumor necrosis factor-mediated signaling pathway Biological Process GO:0016567 protein ubiquitination Biological Process GO:0016579 protein deubiquitination Biological Process GO:0031647 regulation of protein stability Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT3G11910 ath:AT5G06600 hsa:7874 mmu:252870 spo:2541131 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF22486MATH_266-189 aaPF00917MATH71-191 aaPF00443UCH209-530 aaPF13423UCH_1209-484 aaPF00881Nitroreductase480-596 aaPF14560Ubiquitin_2485-502 aaPF16657Malt_amylase_C517-541 aaPF00240ubiquitin530-561 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G205040 | PF22486 | MATH_2 | 66 | 189 | 1.6e-36 | 126.3 |
| TkA08G205040 | PF00917 | MATH | 71 | 191 | 8.2e-17 | 62.2 |
| TkA08G205040 | PF00443 | UCH | 209 | 530 | 4.2e-58 | 197.7 |
| TkA08G205040 | PF13423 | UCH_1 | 209 | 484 | 2.9e-15 | 57.4 |
| TkA08G205040 | PF00881 | Nitroreductase | 480 | 596 | 0.065 | 14.1 |
| TkA08G205040 | PF14560 | Ubiquitin_2 | 485 | 502 | 0.11 | 13.7 |
| TkA08G205040 | PF16657 | Malt_amylase_C | 517 | 541 | 0.14 | 12.9 |
| TkA08G205040 | PF00240 | ubiquitin | 530 | 561 | 0.0017 | 18.8 |
| TkA08G205040 | PF22486 | MATH_2 | 546 | 621 | 1.6e-36 | 126.3 |
| TkA08G205040 | PF12436 | USP7_ICP0_bdg | 557 | 629 | 1.9e-78 | 263.9 |
| TkA08G205040 | PF13423 | UCH_1 | 570 | 584 | 2.9e-15 | 57.4 |
| TkA08G205040 | PF14533 | USP7_C2 | 600 | 642 | 2.5e-59 | 201.1 |
| TkA08G205040 | PF00240 | ubiquitin | 602 | 636 | 0.0017 | 18.8 |
| TkA08G205040 | PF11976 | Rad60-SLD | 604 | 634 | 0.085 | 13.4 |
| TkA08G205040 | PF14560 | Ubiquitin_2 | 605 | 645 | 0.11 | 13.7 |
| TkA08G205040 | PF28203 | CDI_Immunity_Comp | 606 | 647 | 0.065 | 14.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.