RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G204600
Reference: TK1151 Chr: Chr08 Coordinates: 53474349-53477396 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2643 bp · TkA08G204600|TK1151|cDNA

ATGGCGGCCGTGCGGAAGCTCATTGTAGAAGTAGTTGACGCCCGAAATCTTCTCCCAAAAGACGGTCATGGCACATCAAGTCCCTACGTGATTCTTGATTTCTACGGCCAGCGGCGGAAGACCCGGGTGGTGGCTAGGGATTTGAACCCGGTTTGGAATGAGGTTTTGGAATTTAATGTCGGAAAGCCGTCGGATGTGTTCGGTGATATGCTTGAAGTCGATGTTAATCACGATAAGAGTCTTGGGCCGACGACCAGAAC...

CDS

Download CDS FASTA

2643 bp · TkA08G204600|TK1151|CDS

ATGGCGGCCGTGCGGAAGCTCATTGTAGAAGTAGTTGACGCCCGAAATCTTCTCCCAAAAGACGGTCATGGCACATCAAGTCCCTACGTGATTCTTGATTTCTACGGCCAGCGGCGGAAGACCCGGGTGGTGGCTAGGGATTTGAACCCGGTTTGGAATGAGGTTTTGGAATTTAATGTCGGAAAGCCGTCGGATGTGTTCGGTGATATGCTTGAAGTCGATGTTAATCACGATAAGAGTCTTGGGCCGACGACCAGAAC...

Protein

Download Protein FASTA

880 aa · TkA08G204600|TK1151|PROTEIN

MAAVRKLIVEVVDARNLLPKDGHGTSSPYVILDFYGQRRKTRVVARDLNPVWNEVLEFNVGKPSDVFGDMLEVDVNHDKSLGPTTRTNFLGRVRLNSQQFVKKGEEALIYYPLEKKHLFSWIQGEIGLKIYFVDDVAPPPAPPSPPSSEEVKAETKSSEVADAARAGDSEDPPATGKYKPNDEPPPPPPVPEAAPTEPVPPSEASNQDHDSDPDDSGDDHVQPSNPMKQERFDFDQLRTSRSMPNIKISDVSDRFPIERS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G204600
TK1151 IDTkA08G204600
OH-1004 IDLXL04_032783
Relationship / confidenceRbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)85.800
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G204600
LocationChr08:53474349-53477396 (+)
DescriptionSimilar to QKY: Protein QUIRKY
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g17980 May function as a signaling molecule by regulating the trafficking of other regulators. No verified direct reference in this release
At1g74720 May be involved in Ca 2(+)-dependent signaling and membrane trafficking. No verified direct reference in this release
At4g11610 May function as a signaling molecule by regulating the trafficking of other regulators. No verified direct reference in this release
At3g03680 May function as a signaling molecule by regulating the trafficking of other regulators. No verified direct reference in this release
At5g48060 May function as a signaling molecule by regulating the trafficking of other regulators. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_032783 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009911 positive regulation of flower development Biological Process
GO:0010497 plasmodesmata-mediated intercellular transport Biological Process
GO:0048467 gynoecium development Biological Process
GO:0048729 tissue morphogenesis Biological Process
GO:0051211 anisotropic cell growth Biological Process
GO:0099402 plant organ development Biological Process
GO:0000139 Golgi membrane Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005739 mitochondrion Cellular Component
GO:0005783 endoplasmic reticulum Cellular Component
GO:0005789 endoplasmic reticulum membrane Cellular Component
GO:0005829 cytosol Cellular Component
KEGG gene cross-reference
ath:AT1G74720
ath:AT3G03680
ath:AT4G11610
ath:AT5G17980
ath:AT5G48060
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.415
Rank 1 · TkA08G204600 · TK1151
Endoplasmic reticulum0.320
Rank 2 · TkA08G204600 · TK1151
Cytoplasm0.172
Rank 3 · TkA08G204600 · TK1151
Golgi apparatus0.150
Rank 4 · TkA08G204600 · TK1151
Nucleus0.103
Rank 5 · TkA08G204600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00168C26-109 aa
PF11696DUF3292140-160 aa
PF11696DUF3292183-210 aa
PF08372PRT_C253-280 aa
PF00168C2270-376 aa
PF00168C2426-458 aa
PF00168C2477-578 aa
PF11696DUF3292662-748 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G204600PF00168C261091e-45155.0
TkA08G204600PF11696DUF32921401600.0001820.8
TkA08G204600PF11696DUF32921832100.0001820.8
TkA08G204600PF08372PRT_C2532801.1e-68230.7
TkA08G204600PF00168C22703761e-45155.0
TkA08G204600PF00168C24264581e-45155.0
TkA08G204600PF00168C24775781e-45155.0
TkA08G204600PF11696DUF32926627480.0001820.8
TkA08G204600PF04842DUF6396737280.01115.9
TkA08G204600PF02453Reticulon6967350.02115.4
TkA08G204600PF08372PRT_C6987161.1e-68230.7
TkA08G204600PF08372PRT_C7248801.1e-68230.7
TkA08G204600PF11696DUF32928108440.0001820.8
TkA08G204600PF04842DUF6398108520.01115.9
TkA08G204600PF02453Reticulon8118460.02115.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FJG3Arabidopsis thalianasp|Q9FJG3|MCT16_ARATH Multiple C2 domain and transmembrane region protein 1655.400%Swiss-ProtHigh
B8XCH5Arabidopsis thalianasp|B8XCH5|QKY_ARATH Protein QUIRKY42.600%Swiss-ProtMedium
Q84TJ7Arabidopsis thalianasp|Q84TJ7|MCTP7_ARATH Multiple C2 domain and transmembrane region protein 737.600%Swiss-ProtMedium
Q9SS68Arabidopsis thalianasp|Q9SS68|MCT14_ARATH Multiple C2 domain and transmembrane region protein 1438.500%Swiss-ProtMedium
Q9FI32Arabidopsis thalianasp|Q9FI32|MCTP2_ARATH Multiple C2 domain and transmembrane region protein 237.800%Swiss-ProtMedium

JBrowse

View in Genome Browser