TkA08G203590 | RubberDandelionOmics

Gene overview

TkA08G203590

Reference: TK1151 Chr: Chr08 Coordinates: 53231307-53233129 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

954 bp · TkA08G203590|TK1151|cDNA

GTTTCCGTAACCTCGAGAGTATCGGTTTCCCGGTTGGCTTTTGCGACGTTCGCCGATTCAGCGGACCGGCTGTCAAAATTCATACTACTGGCTAAAGTCTCTCGACAGAATGAGATTTCCACTCAGTTGGAGTCAAAATTGTCAATAAAACCCTTTCACATGATTTCAAAATTGTACGATTGTTCGAGGTTATCGGAATGATGCGAAGAAGCCATCCAGAGGTTCTTTGGGCTCAGCGGGGAGATAAAGTTTACCTGACC...

CDS

Download CDS FASTA

459 bp · TkA08G203590|TK1151|CDS

ATGATGCGAAGAAGCCATCCAGAGGTTCTTTGGGCTCAGCGGGGAGATAAAGTTTACCTGACCATAGCCCTGACCAACGCAAAAGACATTGCAGTTAAATGTGAGCCCCATGGACTGTTTAACTTTACCGCCATTGGAGCAAAAGGTGAAGAGTATGAAGTCAGTTTGGAGCTTTATGGAAACATTCTACCTGAGGGATGCAAAACCCAAATGGGATTGAGGAACATACTGTGCACAGTTCAGAAAGAGGAGAAAGGTTG...

Protein

Download Protein FASTA

152 aa · TkA08G203590|TK1151|PROTEIN

MMRRSHPEVLWAQRGDKVYLTIALTNAKDIAVKCEPHGLFNFTAIGAKGEEYEVSLELYGNILPEGCKTQMGLRNILCTVQKEEKGWWKRLLKTDQKPAPYIKVDWNRWCDEDDESANGTDDDDLKYASDDDGSSGDDGMLYLPDLEKVRGM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G203590`
TK1151 ID	TkA08G203590
OH-1004 ID	LXL04_037055
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	44.100
Protein coverage (%)	TK1151 73.026 / OH-1004 46.025 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G203590

Location Chr08:53231307-53233129 (+)

Description Similar to OsI_027940: Uncharacterized protein OsI_027940

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g03773`	Acts as a co-chaperone for HSP90.	Characterization of plant p23-like proteins for their co-chaperone activities.2010 · DOI: 10.1007/s12192-010-0182-1
`At4g02450`	Acts as a co-chaperone for HSP90.	Characterization of plant p23-like proteins for their co-chaperone activities.2010 · DOI: 10.1007/s12192-010-0182-1

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: P0C8Z0`	Uncharacterized protein OsI_027940.	No verified direct reference in this release
`Os08g0359500`	Uncharacterized protein Os08g0359500.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037055 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0006950 response to stress Biological Process

GO:0009408 response to heat Biological Process

GO:0010449 root meristem growth Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0051131 chaperone-mediated protein complex assembly Biological Process

GO:0080037 negative regulation of cytokinin-activated signaling pathway Biological Process

GO:2000012 regulation of auxin polar transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT3G03773

ath:AT4G02450

dosa:Os08g0359500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.633

Rank 1 · TkA08G203590 · TK1151

Nucleus0.422

Rank 2 · TkA08G203590 · TK1151

Mitochondrion0.084

Rank 3 · TkA08G203590 · TK1151

Cell membrane0.074

Rank 4 · TkA08G203590 · TK1151

Endoplasmic reticulum0.063

Rank 5 · TkA08G203590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04969CS8-82 aa

PF18672PilZN130-74 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G203590	`PF04969`	CS	8	82	2.4e-07	32.3
TkA08G203590	`PF18672`	PilZN1	30	74	0.059	14.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6ID70`	Arabidopsis thaliana	sp\|Q6ID70\|P23B_ARATH Co-chaperone protein p23-2	63.700%	Swiss-Prot	High
`Q8L7U4`	Arabidopsis thaliana	sp\|Q8L7U4\|P23A_ARATH Co-chaperone protein p23-1	42.700%	Swiss-Prot	Medium
`P0C8Z0`	Oryza sativa subsp. indica	sp\|P0C8Z0\|Y8359_ORYSI Uncharacterized protein OsI_027940	50.400%	Swiss-Prot	High
`Q6YYB0`	Oryza sativa subsp. japonica	sp\|Q6YYB0\|Y8359_ORYSJ Uncharacterized protein Os08g0359500	50.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card