Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1367 bp · TkA08G203520|TK1151|cDNA
CTCAAATCAACTTGGACCGGAAAAATTGATATATCTAGAGTTTTTCGATTTTATTGTCTTCTTTTCCAACTTGCAAGGAGAAAGCGGATCTGTACTCTGCCCGGATCTTGCCCGAATCTTGCCCGGTCCACTTTATATCCACTCTTTTCGTCAATGGGCTTCTTTCTAGGGTTAAACTGCTTAAGCGAGCTGGAATGCTTCATGTTATAAGCAAAAAACACTGGCAGACGTAAACCAATGAGCAGCAATGGGAAGAAGCC...
987 bp · TkA08G203520|TK1151|CDS
ATGAGCAGCAATGGGAAGAAGCCGAAAAGGGTTGTGCAACTCGCCGATGCCGCCCCTTATGTCCTGCCTTACCTTCATCCGGCGGAGCTATCAGCCATCTCGTTAACCTGCAAAACACTACAGCTCATTGCCAAATCAGTTACCGCCGCCCGTTCATCCGACGCCTGTAGGAACTCCGAGAAACTCCCCATTCCTTTCGTTAACACCAACGTGGACAATCATCCGTACGCCTACTTCATCTATACTCCGACTCAAGTCCT...
Protein
Download Protein FASTA328 aa · TkA08G203520|TK1151|PROTEIN
MSSNGKKPKRVVQLADAAPYVLPYLHPAELSAISLTCKTLQLIAKSVTAARSSDACRNSEKLPIPFVNTNVDNHPYAYFIYTPTQVLSFSNDLPRQPWGLCSIERPDIGLILPPTIEDGSRCECERCDNDLTACLCSRQNFSELRWECGSGCKCDFECPNRVSQRGISIRLKIVRSQRKGWGLHADQFIPSGEFICEYAGELLTTKEARNRQQTYDKNTSTNKQTSALLVVREHLPSGNACLRINIDATKIGNIARFINH...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G203520 |
|---|---|
| TK1151 ID | TkA08G203520 |
| OH-1004 ID | LXL04_032764 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 97.900 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G203520 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:53203958-53205824 (+) | |||||||||
| Description | Similar to SUVR3: Histone-lysine N-methyltransferase SUVR3 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000729 DNA double-strand break processing Biological Process GO:0006303 double-strand break repair via nonhomologous end joining Biological Process GO:0006308 DNA catabolic process Biological Process GO:0008283 cell population proliferation Biological Process GO:0015074 DNA integration Biological Process GO:0031297 replication fork processing Biological Process GO:0032259 methylation Biological Process GO:0044774 mitotic DNA integrity checkpoint signaling Biological Process GO:0045814 negative regulation of gene expression, epigenetic Biological Process GO:0045892 negative regulation of DNA-templated transcription Biological Process GO:0090304 nucleic acid metabolic process Biological Process GO:2000373 positive regulation of DNA topoisomerase (ATP-hydrolyzing) activity Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT3G03750 bta:511299 hsa:6419 mmu:74729 rno:500281 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF12937F-box-like21-45 aaPF05033Pre-SET58-161 aaPF00856SET180-301 aaPF05033Pre-SET211-222 aaPF05033Pre-SET310-318 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G203520 | PF12937 | F-box-like | 21 | 45 | 0.066 | 13.7 |
| TkA08G203520 | PF05033 | Pre-SET | 58 | 161 | 0.015 | 16.5 |
| TkA08G203520 | PF00856 | SET | 180 | 301 | 5.8e-21 | 75.6 |
| TkA08G203520 | PF05033 | Pre-SET | 211 | 222 | 0.015 | 16.5 |
| TkA08G203520 | PF05033 | Pre-SET | 310 | 318 | 0.015 | 16.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.