TkA08G194530 | RubberDandelionOmics

Gene overview

TkA08G194530

Reference: TK1151 Chr: Chr08 Coordinates: 50840689-50842886 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

715 bp · TkA08G194530|TK1151|cDNA

TTTAAAACTTCCAACATCCTTCTGGACGATCAATGGAATGCTAAACTTTCGGATTTTGGAACAGCACGGTTAGGTCCTGAAGAAGGACATAGTTCCATTTTAACCTCGTTTGTAGGAACTGCTATGTATGCAGCTCCAGAGTACCTAGCTACAGGGTATTTGACATCCAAGAGCGACGTATATAGCTATGGGGTATTCCTATATGAACTTATTACAGGTAGGCGCCCACATGATAAGTCTTGGCCTCTAGGCCAGCGAAA...

CDS

Download CDS FASTA

363 bp · TkA08G194530|TK1151|CDS

TTTAAAACTTCCAACATCCTTCTGGACGATCAATGGAATGCTAAACTTTCGGATTTTGGAACAGCACGGTTAGGTCCTGAAGAAGGACATAGTTCCATTTTAACCTCGTTTGTAGGAACTGCTATGTATGCAGCTCCAGAGTACCTAGCTACAGGGTATTTGACATCCAAGAGCGACGTATATAGCTATGGGGTATTCCTATATGAACTTATTACAGGTAGGCGCCCACATGATAAGTCTTGGCCTCTAGGCCAGCGAAA...

Protein

Download Protein FASTA

120 aa · TkA08G194530|TK1151|PROTEIN

FKTSNILLDDQWNAKLSDFGTARLGPEEGHSSILTSFVGTAMYAAPEYLATGYLTSKSDVYSYGVFLYELITGRRPHDKSWPLGQRNLITWAIPYSHSKRIHRIIDLRIVELEGMYKKKQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G194530`
TK1151 ID	TkA08G194530
OH-1004 ID	LXL04_032657
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	81.400
Protein coverage (%)	TK1151 98.333 / OH-1004 26.593 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G194530

Location Chr08:50840689-50842886 (-)

Description Similar to PCRK2: Serine/threonine-protein kinase PCRK2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g03320`	Functions redundantly with PCRK1 in basal resistance against bacterial pathogens and in regulation of plant immunity.	No verified direct reference in this release
`At3g09830`	Involved in the activation of early immune responses.	The receptor-like cytoplasmic kinase PCRK1 contributes to pattern-triggered immunity against Pseudomonas syringae in Arabidopsis thaliana.2015 · DOI: 10.1111/nph.13345 Functional characterization of PCRK1, a putative protein kinase with a role in immunity.2015 · DOI: 10.1080/15592324.2015.1063759
`At1g07570`	Possible bi-functional kinase.	Novel protein kinase of Arabidopsis thaliana (APK1) that phosphorylates tyrosine, serine and threonine.1992 · DOI: 10.1007/bf00046450
`At5g02290`	May play a role in the regulation of plant growth and development (Probable).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0110900`	Functions downstream of CERK1 in the microbial peptidoglycans (PGNs) and fungal chitin signaling pathways that mediate innate immunity.	OsCERK1 and OsRLCK176 play important roles in peptidoglycan and chitin signaling in rice innate immunity.2014 · DOI: 10.1111/tpj.12710

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032657 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002221 pattern recognition receptor signaling pathway Biological Process

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0007166 cell surface receptor signaling pathway Biological Process

GO:0009617 response to bacterium Biological Process

GO:0010073 meristem maintenance Biological Process

GO:0010078 maintenance of root meristem identity Biological Process

GO:0010088 phloem development Biological Process

GO:0010492 maintenance of shoot apical meristem identity Biological Process

GO:0031663 lipopolysaccharide-mediated signaling pathway Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0080142 regulation of salicylic acid biosynthetic process Biological Process

KEGG gene cross-reference

ath:AT1G26970

ath:AT3G09830

ath:AT3G28690

ath:AT5G03320

ath:AT5G15080

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.517

Rank 1 · TkA08G194530 · TK1151

Nucleus0.238

Rank 2 · TkA08G194530 · TK1151

Cell membrane0.209

Rank 3 · TkA08G194530 · TK1151

Endoplasmic reticulum0.118

Rank 4 · TkA08G194530 · TK1151

Golgi apparatus0.097

Rank 5 · TkA08G194530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase2-79 aa

PF07714PK_Tyr_Ser-Thr3-79 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G194530	`PF00069`	Pkinase	2	79	1.1e-19	71.5
TkA08G194530	`PF07714`	PK_Tyr_Ser-Thr	3	79	2.8e-14	53.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZF8`	Arabidopsis thaliana	sp\|Q9LZF8\|PCRK2_ARATH Serine/threonine-protein kinase PCRK2	60.700%	Swiss-Prot	High
`Q9SF86`	Arabidopsis thaliana	sp\|Q9SF86\|PCRK1_ARATH Serine/threonine-protein kinase PCRK1	60.700%	Swiss-Prot	High
`Q06548`	Arabidopsis thaliana	sp\|Q06548\|PBL9_ARATH Probable serine/threonine-protein kinase PBL9	59.500%	Swiss-Prot	High
`P43293`	Arabidopsis thaliana	sp\|P43293\|PBL11_ARATH Probable serine/threonine-protein kinase PBL11	56.400%	Swiss-Prot	High
`Q65XV8`	Oryza sativa subsp. japonica	sp\|Q65XV8\|RK176_ORYSJ Receptor-like cytoplasmic kinase 176	59.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card