TkA08G193680 | RubberDandelionOmics

Gene overview

TkA08G193680

Reference: TK1151 Chr: Chr08 Coordinates: 50602056-50602391 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

336 bp · TkA08G193680|TK1151|cDNA

ATGGACGGGATGTCGGCTAAAAAGACGGTGTTCATAATCGGTGCGACTAACCGACCGGATATAATCGACCCAACGCTTCTCCGACCCAGTCGACTCGACCAGCTGATTTACATCCCTCTCCCTGATGAAGAATCCCGTTACTCCATCTTCAAGTCCGCATTAAGAAAGTCCCCAGTTGCAAAAGACGTGGACCTTCACGCGCTTGCAAAGTACACACAAGGCTTCAGTGGCGCTGACATCACTGAAATATGTCAGCGCGC...

CDS

Download CDS FASTA

336 bp · TkA08G193680|TK1151|CDS

ATGGACGGGATGTCGGCTAAAAAGACGGTGTTCATAATCGGTGCGACTAACCGACCGGATATAATCGACCCAACGCTTCTCCGACCCAGTCGACTCGACCAGCTGATTTACATCCCTCTCCCTGATGAAGAATCCCGTTACTCCATCTTCAAGTCCGCATTAAGAAAGTCCCCAGTTGCAAAAGACGTGGACCTTCACGCGCTTGCAAAGTACACACAAGGCTTCAGTGGCGCTGACATCACTGAAATATGTCAGCGCGC...

Protein

Download Protein FASTA

111 aa · TkA08G193680|TK1151|PROTEIN

MDGMSAKKTVFIIGATNRPDIIDPTLLRPSRLDQLIYIPLPDEESRYSIFKSALRKSPVAKDVDLHALAKYTQGFSGADITEICQRACKYAIRENIEKVSRWLNLLLLFIY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G193680`
TK1151 ID	TkA08G193680
OH-1004 ID	LXL04_013079
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	90.800
Protein coverage (%)	TK1151 88.288 / OH-1004 12.039 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G193680

Location Chr08:50602056-50602391 (+)

Description Similar to CAFP: Cell division cycle protein 48 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g53230`	Probably functions in cell division and growth processes.	No verified direct reference in this release
`At3g09840`	Probably functions in cell division and growth processes (Probable).	Ubiquitin-dependent chloroplast-associated protein degradation in plants.2019 · DOI: 10.1126/science.aav4467 The CDC48 complex mediates ubiquitin-dependent degradation of intra-chloroplast proteins in plants.2022 · DOI: 10.1016/j.celrep.2022.110664
`At5g03340`	Probably functions in cell division and growth processes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013079 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0009846 pollen germination Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010498 proteasomal protein catabolic process Biological Process

GO:0030162 regulation of proteolysis Biological Process

GO:0030970 retrograde protein transport, ER to cytosol Biological Process

GO:0031348 negative regulation of defense response Biological Process

GO:0031648 protein destabilization Biological Process

GO:0034614 cellular response to reactive oxygen species Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0045732 positive regulation of protein catabolic process Biological Process

GO:0051228 mitotic spindle disassembly Biological Process

KEGG gene cross-reference

ath:AT3G09840

ath:AT3G53230

ath:AT5G03340

cann:107847567

gmx:547850

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.339

Rank 1 · TkA08G193680 · TK1151

Mitochondrion0.246

Rank 2 · TkA08G193680 · TK1151

Nucleus0.183

Rank 3 · TkA08G193680 · TK1151

Peroxisome0.181

Rank 4 · TkA08G193680 · TK1151

Lysosome / Vacuole0.034

Rank 5 · TkA08G193680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00004AAA1-40 aa

PF23902AAA_lid_PRS2_C44-101 aa

PF17862AAA_lid_362-100 aa

PF28760ARC_lid75-103 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G193680	`PF00004`	AAA	1	40	2.2e-07	32.1
TkA08G193680	`PF23902`	AAA_lid_PRS2_C	44	101	0.0027	18.5
TkA08G193680	`PF17862`	AAA_lid_3	62	100	1.9e-14	53.6
TkA08G193680	`PF28760`	ARC_lid	75	103	0.042	14.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SCN8`	Arabidopsis thaliana	sp\|Q9SCN8\|CD48D_ARATH Cell division control protein 48 homolog D	92.900%	Swiss-Prot	High
`P54609`	Arabidopsis thaliana	sp\|P54609\|CD48A_ARATH Cell division control protein 48 homolog A	88.800%	Swiss-Prot	High
`Q9LZF6`	Arabidopsis thaliana	sp\|Q9LZF6\|CD48E_ARATH Cell division control protein 48 homolog E	88.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card