TkA08G192150 | RubberDandelionOmics

Gene overview

TkA08G192150

Reference: TK1151 Chr: Chr08 Coordinates: 50204295-50205640 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1281 bp · TkA08G192150|TK1151|cDNA

ATGTTCGGTTCATACTCCGGCGACGTGAAGTCTTCCCTAGGATATGACCAAACCACCCTCAACCTCCTTAGCACCTTCAAAGACCTGGGTAGCAATGTCGGGGTCATATCAGGTCTAATTAACGAAATCTCCCCTCCATGGGTGGTCCTCCTCATCGGCGCCACCATGAACTTCTCCGGCTACTTCATGATCTGGCTCGCCGTCACCGGAAAAATAAAAAAACCCAGCCTCTGGCAAATGTGCTTGTACATTTGCATCGG...

CDS

Download CDS FASTA

1281 bp · TkA08G192150|TK1151|CDS

ATGTTCGGTTCATACTCCGGCGACGTGAAGTCTTCCCTAGGATATGACCAAACCACCCTCAACCTCCTTAGCACCTTCAAAGACCTGGGTAGCAATGTCGGGGTCATATCAGGTCTAATTAACGAAATCTCCCCTCCATGGGTGGTCCTCCTCATCGGCGCCACCATGAACTTCTCCGGCTACTTCATGATCTGGCTCGCCGTCACCGGAAAAATAAAAAAACCCAGCCTCTGGCAAATGTGCTTGTACATTTGCATCGG...

Protein

Download Protein FASTA

426 aa · TkA08G192150|TK1151|PROTEIN

MFGSYSGDVKSSLGYDQTTLNLLSTFKDLGSNVGVISGLINEISPPWVVLLIGATMNFSGYFMIWLAVTGKIKKPSLWQMCLYICIGANSQTFANTGALVTCVKNFPESRGVVLGLLKGFVGLSGAIITQLYHAIYGHDSRSLILFIGWLPAAVSMVFLRTVRIMKVVRLTNELRMFYKLLYISLGLAGFLMVIIVIQNSFKFSKPEFVGCASVVVILLFAPFLVVFKEELNLWKSKQDAVKIAMISPVKIVTEAPNRSQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G192150`
TK1151 ID	TkA08G192150
OH-1004 ID	LXL04_014929
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	77.300
Protein coverage (%)	TK1151 79.812 / OH-1004 56.198 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G192150`
Location	Chr08:50204295-50205640 (+)
Description	Similar to NFD4: Protein NUCLEAR FUSION DEFECTIVE 4
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_014929` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000741 karyogamy Biological Process GO:0009651 response to salt stress Biological Process GO:0010197 polar nucleus fusion Biological Process GO:0005634 nucleus Cellular Component GO:0005739 mitochondrion Cellular Component GO:0016020 membrane Cellular Component GO:0022857 transmembrane transporter activity Molecular Function
KEGG gene cross-reference	ath:AT1G31470 yli:2906009 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.409

Rank 1 · TkA08G192150 · TK1151

Lysosome / Vacuole0.314

Rank 2 · TkA08G192150 · TK1151

Endoplasmic reticulum0.176

Rank 3 · TkA08G192150 · TK1151

Cytoplasm0.107

Rank 4 · TkA08G192150 · TK1151

Golgi apparatus0.087

Rank 5 · TkA08G192150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06813Nodulin-like1-227 aa

PF03419Peptidase_U434-75 aa

PF03419Peptidase_U4123-253 aa

PF03419Peptidase_U4292-322 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G192150	`PF06813`	Nodulin-like	1	227	1.7e-85	287.2
TkA08G192150	`PF03419`	Peptidase_U4	34	75	1.5	8.7
TkA08G192150	`PF03419`	Peptidase_U4	123	253	1.5	8.7
TkA08G192150	`PF03419`	Peptidase_U4	292	322	1.5	8.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card