TkA08G191670 | RubberDandelionOmics

Gene overview

TkA08G191670

Reference: TK1151 Chr: Chr08 Coordinates: 50093700-50094327 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

366 bp · TkA08G191670|TK1151|cDNA

ATGCAAATACGCCATAGAGATTTGAAGCTTGAGAACACTCTTTTAGAAGGGAACCCTGCACCTCGCCTGAAAATCTGTGATTTTGCCTACTCAAGGTCATCTCTTCTACACTCAAGACCCAAGTCATTAGTTGGAACTCCTGCTTACATTGCCCCTGAGGTTCTTTCTCGCAGAGAGTATGATGGAAAGGTCAAAGATATTTGGTCTTGTGGAGTGACACCCTTTTGGTCTTGTGATGCTTGTGGGAGCATACCCTTTGA...

CDS

Download CDS FASTA

366 bp · TkA08G191670|TK1151|CDS

ATGCAAATACGCCATAGAGATTTGAAGCTTGAGAACACTCTTTTAGAAGGGAACCCTGCACCTCGCCTGAAAATCTGTGATTTTGCCTACTCAAGGTCATCTCTTCTACACTCAAGACCCAAGTCATTAGTTGGAACTCCTGCTTACATTGCCCCTGAGGTTCTTTCTCGCAGAGAGTATGATGGAAAGGTCAAAGATATTTGGTCTTGTGGAGTGACACCCTTTTGGTCTTGTGATGCTTGTGGGAGCATACCCTTTGA...

Protein

Download Protein FASTA

121 aa · TkA08G191670|TK1151|PROTEIN

MQIRHRDLKLENTLLEGNPAPRLKICDFAYSRSSLLHSRPKSLVGTPAYIAPEVLSRREYDGKVKDIWSCGVTPFWSCDACGSIPFEDRKDPKNFRKTIHVSIVQNHKEKVPIELEKQMKR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G191670`
TK1151 ID	TkA08G191670
OH-1004 ID	LXL04_038754
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	79.000
Protein coverage (%)	TK1151 82.645 / OH-1004 24.873 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G191670

Location Chr08:50093700-50094327 (-)

Description Similar to SRK2B: Serine/threonine-protein kinase SRK2B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g10940`	Serine/threonine-protein kinase SRK2A.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0691100`	May play a role in signal transduction of hyperosmotic response.	No verified direct reference in this release
`Os02g0551100`	May play a role in signal transduction of hyperosmotic response (Probable).	No verified direct reference in this release
`Os04g0432000`	May play a role in signal transduction of hyperosmotic response.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038754 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0048527 lateral root development Biological Process

GO:0080022 primary root development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G10940

ath:AT1G60940

ath:AT5G63650

dosa:Os02g0551100

dosa:Os04g0432000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.478

Rank 1 · TkA08G191670 · TK1151

Nucleus0.305

Rank 2 · TkA08G191670 · TK1151

Mitochondrion0.101

Rank 3 · TkA08G191670 · TK1151

Extracellular0.095

Rank 4 · TkA08G191670 · TK1151

Endoplasmic reticulum0.054

Rank 5 · TkA08G191670 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase2-106 aa

PF12330Haspin_kinase2-34 aa

PF07714PK_Tyr_Ser-Thr3-120 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G191670	`PF00069`	Pkinase	2	106	1.3e-21	78.0
TkA08G191670	`PF12330`	Haspin_kinase	2	34	0.049	13.4
TkA08G191670	`PF07714`	PK_Tyr_Ser-Thr	3	120	2.7e-09	37.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P43291`	Arabidopsis thaliana	sp\|P43291\|SRK2A_ARATH Serine/threonine-protein kinase SRK2A	78.800%	Swiss-Prot	High
`Q7XKA8`	Oryza sativa subsp. japonica	sp\|Q7XKA8\|SAPK5_ORYSJ Serine/threonine-protein kinase SAPK5	79.800%	Swiss-Prot	High
`Q6ZI44`	Oryza sativa subsp. japonica	sp\|Q6ZI44\|SAPK6_ORYSJ Serine/threonine-protein kinase SAPK6	77.800%	Swiss-Prot	High
`Q7XQP4`	Oryza sativa subsp. japonica	sp\|Q7XQP4\|SAPK7_ORYSJ Serine/threonine-protein kinase SAPK7	77.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card