Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1896 bp · TkA08G190540|TK1151|cDNA
GCCTCAAAAATATTTTTATTTAATTATTTATAAAAATTTGGGTAGACGCCTAGACCCCAAGATAAACCCACGGTTTCACAGCATTCGGGTATATAAACCATTTCTCAGATCGGCTTCACTTGCCAAGAACAATTACAGTCAGCTGAACTCCACCATGAGCAACAACGAGTCCACCACCACCACTACCACCACCGCCGCCGCTGCCGCCGCAGACTCTCCAATCACCAAACCGTCGGTCGTCGGAAGATGGGCTGACGAGC...
1662 bp · TkA08G190540|TK1151|CDS
CCTCAAAAATATTTTTATTTAATTATTTATAAAAATTTGGGTAGACGCCTAGACCCCAAGATAAACCCACGGTTTCACAGCATTCGGGTATATAAACCATTTCTCAGATCGGCTTCACTTGCCAAGAACAATTACAGTCAGCTGAACTCCACCATGAGCAACAACGAGTCCACCACCACCACTACCACCACCGCCGCCGCTGCCGCCGCAGACTCTCCAATCACCAAACCGTCGGTCGTCGGAAGATGGGCTGACGAGCC...
Protein
Download Protein FASTA553 aa · TkA08G190540|TK1151|PROTEIN
PQKYFYLIIYKNLGRRLDPKINPRFHSIRVYKPFLRSASLAKNNYSQLNSTMSNNESTTTTTTTAAAAAADSPITKPSVVGRWADEPDDVPEEPDAPSTSSATDEVKLESLAIDESKKVNNFLDDPDDSNIEAVTGETPYTSAVRFEDLNLSPELLKGLYVEMKFERPSKIQSISLPMILTPPYKNLIAQAHNGSGKTTCFVLGMLSRVDPKLGVPQALCICPTRELAIQNMEVLLKMGKFTGITSELGLPADKANYIPI...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G190540 |
|---|---|
| TK1151 ID | TkA08G190540 |
| OH-1004 ID | LXL04_032596 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 95.600 |
| Protein coverage (%) | TK1151 98.373 / OH-1004 92.268Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G190540 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:49783549-49786077 (+) | ||||||||||||
| Description | Similar to RH38: DEAD-box ATP-dependent RNA helicase 38 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0006406 mRNA export from nucleus Biological Process GO:0006409 tRNA export from nucleus Biological Process GO:0006415 translational termination Biological Process GO:0009408 response to heat Biological Process GO:0009409 response to cold Biological Process GO:0009737 response to abscisic acid Biological Process GO:0010467 gene expression Biological Process GO:0015031 protein transport Biological Process GO:0016973 poly(A)+ mRNA export from nucleus Biological Process GO:0051028 mRNA transport Biological Process GO:0005634 nucleus Cellular Component GO:0005635 nuclear envelope Cellular Component | ||||||||||||
| KEGG gene cross-reference | ath:AT3G53110 cal:CAALFM_C301860CA dosa:Os03g0158200 sce:YOR046C These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF19233DUF5886113-132 aaPF00270DEAD170-342 aaPF00271Helicase_C217-237 aaPF00271Helicase_C316-341 aaPF19233DUF5886319-410 aaPF23361BBS7_pf355-399 aaPF00271Helicase_C391-502 aaPF00270DEAD392-457 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G190540 | PF19233 | DUF5886 | 113 | 132 | 0.27 | 12.2 |
| TkA08G190540 | PF00270 | DEAD | 170 | 342 | 2.2e-35 | 122.6 |
| TkA08G190540 | PF00271 | Helicase_C | 217 | 237 | 9.3e-27 | 94.2 |
| TkA08G190540 | PF00271 | Helicase_C | 316 | 341 | 9.3e-27 | 94.2 |
| TkA08G190540 | PF19233 | DUF5886 | 319 | 410 | 0.27 | 12.2 |
| TkA08G190540 | PF23361 | BBS7_pf | 355 | 399 | 0.18 | 12.7 |
| TkA08G190540 | PF00271 | Helicase_C | 391 | 502 | 9.3e-27 | 94.2 |
| TkA08G190540 | PF00270 | DEAD | 392 | 457 | 2.2e-35 | 122.6 |
| TkA08G190540 | PF26872 | Phage_186_Dhr | 423 | 454 | 0.22 | 12.0 |
| TkA08G190540 | PF23361 | BBS7_pf | 424 | 475 | 0.18 | 12.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.