TkA08G189480 | RubberDandelionOmics

Gene overview

TkA08G189480

Reference: TK1151 Chr: Chr08 Coordinates: 49500057-49500485 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

429 bp · TkA08G189480|TK1151|cDNA

GCCATCGTAGCGATCGTGGTCGCAAATTCAGTGCTACTACTTGTGATCGCTTCGTTCCTAATTGCATATTACTGCGGAAGGAGATCTGTAACCTCAAATTCAAAATTAGGTTCTGAGATCGGAAAAGGCAGAAGCAGCTACGGCAGTGAAAGCAGAGTATATGCAACCAATGGCGGTGGTGGAGTAGACGGCGATGGGAATAACAAACTGGTATTCTTCGATAAAAAGAAAAAGTTCGAATTAGAGGATTTATTGCGAGC...

CDS

Download CDS FASTA

429 bp · TkA08G189480|TK1151|CDS

GCCATCGTAGCGATCGTGGTCGCAAATTCAGTGCTACTACTTGTGATCGCTTCGTTCCTAATTGCATATTACTGCGGAAGGAGATCTGTAACCTCAAATTCAAAATTAGGTTCTGAGATCGGAAAAGGCAGAAGCAGCTACGGCAGTGAAAGCAGAGTATATGCAACCAATGGCGGTGGTGGAGTAGACGGCGATGGGAATAACAAACTGGTATTCTTCGATAAAAAGAAAAAGTTCGAATTAGAGGATTTATTGCGAGC...

Protein

Download Protein FASTA

142 aa · TkA08G189480|TK1151|PROTEIN

AIVAIVVANSVLLLVIASFLIAYYCGRRSVTSNSKLGSEIGKGRSSYGSESRVYATNGGGGVDGDGNNKLVFFDKKKKFELEDLLRASAEMLGKGSLGTVYRAVLDDGCTVVAVKRLKDANPCGRKEFEQYMDVIGKLKHPM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G189480`
TK1151 ID	TkA08G189480
OH-1004 ID	LXL04_032582
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 99.296 / OH-1004 20.644 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G189480

Location Chr08:49500057-49500485 (+)

Description Similar to PXC1: Leucine-rich repeat receptor-like protein kinase PXC1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g36570`	Leucine-rich repeat receptor-like protein kinase involved in secondary cell wall formation in xylem fibers.	The Arabidopsis LRR-RLK, PXC1, is a regulator of secondary wall formation correlated with the TDIF-PXY/TDR-WOX4 signaling pathway.2013 · DOI: 10.1186/1471-2229-13-94
`At1g68400`	Probable leucine-rich repeat receptor-like protein kinase At1g68400.	No verified direct reference in this release
`At2g26730`	Probable inactive receptor kinase At2g26730.	No verified direct reference in this release
`At3g08680`	Probable inactive receptor kinase At3g08680.	No verified direct reference in this release
`At4g23740`	Probable inactive receptor kinase At4g23740.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032582 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009898 cytoplasmic side of plasma membrane Cellular Component

GO:0016328 lateral plasma membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G68400

ath:AT2G26730

ath:AT2G36570

ath:AT3G08680

ath:AT5G58300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.864

Rank 1 · TkA08G189480 · TK1151

Endoplasmic reticulum0.097

Rank 2 · TkA08G189480 · TK1151

Cytoplasm0.068

Rank 3 · TkA08G189480 · TK1151

Nucleus0.046

Rank 4 · TkA08G189480 · TK1151

Golgi apparatus0.025

Rank 5 · TkA08G189480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase89-141 aa

PF03109ABC189-117 aa

PF07714PK_Tyr_Ser-Thr90-141 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G189480	`PF00069`	Pkinase	89	141	0.0017	18.5
TkA08G189480	`PF03109`	ABC1	89	117	0.013	15.3
TkA08G189480	`PF07714`	PK_Tyr_Ser-Thr	90	141	0.00042	20.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJQ1`	Arabidopsis thaliana	sp\|Q9SJQ1\|PXC1_ARATH Leucine-rich repeat receptor-like protein kinase PXC1	54.700%	Swiss-Prot	High
`Q9M9C5`	Arabidopsis thaliana	sp\|Q9M9C5\|Y1680_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g68400	49.300%	Swiss-Prot	Medium
`O48788`	Arabidopsis thaliana	sp\|O48788\|Y2267_ARATH Probable inactive receptor kinase At2g26730	56.400%	Swiss-Prot	Medium
`Q9C9Y8`	Arabidopsis thaliana	sp\|Q9C9Y8\|Y3868_ARATH Probable inactive receptor kinase At3g08680	44.600%	Swiss-Prot	Medium
`Q9SUQ3`	Arabidopsis thaliana	sp\|Q9SUQ3\|Y4374_ARATH Probable inactive receptor kinase At4g23740	59.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card