TkA08G189070 | RubberDandelionOmics

Gene overview

TkA08G189070

Reference: TK1151 Chr: Chr08 Coordinates: 49390825-49391217 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

393 bp · TkA08G189070|TK1151|cDNA

ATGCTTGGAATTTCTCACCATGGACGCCTTTCTCCCAGGACTAAGCTTATATCCACCAGAGTGAAGTTCAGCTTCAACGGACTTCCTCCAATTTCTTCACTAGATGGCGTCTCTATCGATTTATCTGCAATCGCCAGCCGTGCGGAGAGCCTTATGTATACTTTGGCTGATGCAGCGGTTGCTGTTGATTCTGCTGCTTCTGTTTCCGGGGACTCGGCTACTACGACGGTGCAGAAGTCCGGGGGATGGTTCGGTTTTAT...

CDS

Download CDS FASTA

393 bp · TkA08G189070|TK1151|CDS

ATGCTTGGAATTTCTCACCATGGACGCCTTTCTCCCAGGACTAAGCTTATATCCACCAGAGTGAAGTTCAGCTTCAACGGACTTCCTCCAATTTCTTCACTAGATGGCGTCTCTATCGATTTATCTGCAATCGCCAGCCGTGCGGAGAGCCTTATGTATACTTTGGCTGATGCAGCGGTTGCTGTTGATTCTGCTGCTTCTGTTTCCGGGGACTCGGCTACTACGACGGTGCAGAAGTCCGGGGGATGGTTCGGTTTTAT...

Protein

Download Protein FASTA

130 aa · TkA08G189070|TK1151|PROTEIN

MLGISHHGRLSPRTKLISTRVKFSFNGLPPISSLDGVSIDLSAIASRAESLMYTLADAAVAVDSAASVSGDSATTTVQKSGGWFGFIFDAMEVVLKVVSYSNFVGFVRTINLCTKAITGFLDSWLKLLEP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G189070`
TK1151 ID	TkA08G189070
OH-1004 ID	LXL04_032571
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	91.900
Protein coverage (%)	TK1151 76.154 / OH-1004 28.530 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G189070

Location Chr08:49390825-49391217 (-)

Description Similar to ALB3: Inner membrane protein ALBINO3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g28800`	Required for the insertion of some light harvesting chlorophyll-binding proteins (LHCP) into the chloroplast thylakoid membrane.	ALBINO3, an Arabidopsis nuclear gene essential for chloroplast differentiation, encodes a chloroplast protein that shows homology to proteins present in bacterial membranes and yeast mitochondria.1997 · DOI: 10.1105/tpc.9.5.717

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032571 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009658 chloroplast organization Biological Process

GO:0010027 thylakoid membrane organization Biological Process

GO:0045038 protein import into chloroplast thylakoid membrane Biological Process

GO:0051205 protein insertion into membrane Biological Process

GO:0070208 protein heterotrimerization Biological Process

GO:0072598 protein localization to chloroplast Biological Process

GO:0005777 peroxisome Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0032991 protein-containing complex Cellular Component

KEGG gene cross-reference

ath:AT1G24490

ath:AT2G28800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.969

Rank 1 · TkA08G189070 · TK1151

Nucleus0.031

Rank 2 · TkA08G189070 · TK1151

Mitochondrion0.031

Rank 3 · TkA08G189070 · TK1151

Cytoplasm0.027

Rank 4 · TkA08G189070 · TK1151

Cell membrane0.014

Rank 5 · TkA08G189070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF31132Hel_4HB_N33-69 aa

PF09578Spore_YabQ80-110 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G189070	`PF31132`	Hel_4HB_N	33	69	0.03	15.3
TkA08G189070	`PF09578`	Spore_YabQ	80	110	0.17	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LBP4`	Arabidopsis thaliana	sp\|Q8LBP4\|ALB3_ARATH Inner membrane protein ALBINO3, chloroplastic	57.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card