TkA08G188620 | RubberDandelionOmics

Gene overview

TkA08G188620

Reference: TK1151 Chr: Chr08 Coordinates: 49297473-49300749 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1715 bp · TkA08G188620|TK1151|cDNA

CCTCAACCTCCTCCAAATACATGGCATTCTTCCTGTGTTAACTCCACTCAAATTTCACAGTTCTCCTTATATTTCTCTATCTCTGCATTTTAATCTCACCGGAGAAGCATTATGGCCACCATTAAGGAAGTAAAAGCACGACAAATCTTCGACAGCAGAGGCAATCCTACCGTCGAGGTGGACATTGGACTATCAAATGGTACATGGCACCGAGCTGCTGTTCCCAGTGGGGCATCCACTGGTGTCTACGAAGCACTAGA...

CDS

Download CDS FASTA

1335 bp · TkA08G188620|TK1151|CDS

ATGGCCACCATTAAGGAAGTAAAAGCACGACAAATCTTCGACAGCAGAGGCAATCCTACCGTCGAGGTGGACATTGGACTATCAAATGGTACATGGCACCGAGCTGCTGTTCCCAGTGGGGCATCCACTGGTGTCTACGAAGCACTAGAACTAAGAGATGGAGGCTCAGACTACCTAGGAAAGGGTGTTTCCAAGGCTGTTTCCAATGTGAACTCCATCATTGGCCCTGCTATTGTAGGCAAGGATCCAGCTGATCAAAC...

Protein

Download Protein FASTA

444 aa · TkA08G188620|TK1151|PROTEIN

MATIKEVKARQIFDSRGNPTVEVDIGLSNGTWHRAAVPSGASTGVYEALELRDGGSDYLGKGVSKAVSNVNSIIGPAIVGKDPADQTAIDNYMVQELDGTKNEWGWCKQKLGANAILAVSLAVCKAGASVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPIGASSFKEAMKMGVEVYHNLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIGQAGYTDKVVIGMDVAASEFYGKD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G188620`
TK1151 ID	TkA08G188620
OH-1004 ID	LXL04_032567
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	94.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G188620

Location Chr08:49297473-49300749 (-)

Description Similar to PGH1: Enolase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g36530`	Multifunctional enzyme that acts as an enolase involved in the metabolism and as a positive regulator of cold-responsive gene transcription.	LOS2, a genetic locus required for cold-responsive gene transcription encodes a bi-functional enolase.2002 · DOI: 10.1093/emboj/21.11.2692 Quantitative proteomics of the tonoplast reveals a role for glycolytic enzymes in salt tolerance.2009 · DOI: 10.1105/tpc.109.069211

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032567 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006096 glycolytic process Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0009409 response to cold Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:0000015 phosphopyruvate hydratase complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005740 mitochondrial envelope Cellular Component

GO:0005741 mitochondrial outer membrane Cellular Component

KEGG gene cross-reference

ath:AT2G36530

rcu:8288376

sly:544068

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.723

Rank 1 · TkA08G188620 · TK1151

Nucleus0.264

Rank 2 · TkA08G188620 · TK1151

Mitochondrion0.147

Rank 3 · TkA08G188620 · TK1151

Cell membrane0.109

Rank 4 · TkA08G188620 · TK1151

Endoplasmic reticulum0.070

Rank 5 · TkA08G188620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03952Enolase_N4-139 aa

PF00113Enolase_C148-440 aa

PF27658UCP005278205-257 aa

PF15868MBF2236-288 aa

PF13378MR_MLE_C292-402 aa

PF07476MAAL_C316-400 aa

PF27658UCP005278323-335 aa

PF15868MBF2335-390 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G188620	`PF03952`	Enolase_N	4	139	5e-53	179.5
TkA08G188620	`PF00113`	Enolase_C	148	440	2e-158	527.0
TkA08G188620	`PF27658`	UCP005278	205	257	0.11	12.5
TkA08G188620	`PF15868`	MBF2	236	288	0.18	13.0
TkA08G188620	`PF13378`	MR_MLE_C	292	402	2.2e-06	28.3
TkA08G188620	`PF07476`	MAAL_C	316	400	5.4e-05	23.2
TkA08G188620	`PF27658`	UCP005278	323	335	0.11	12.5
TkA08G188620	`PF15868`	MBF2	335	390	0.18	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P25696`	Arabidopsis thaliana	sp\|P25696\|ENO2_ARATH Bifunctional enolase 2/transcriptional activator	89.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card