Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3202 bp · TkA08G185810|TK1151|cDNA
CGGATACCTTGACTTCCTCCTCACACCTCCTCCTCCCTCAGCCTGGGTTGCCGACCTGTTCTAGCCACACTCAACGATTCACTGGTTCAGTGGATTGAACGCAAAGGCAAAGAACTAGTGAACGGCTATTTCTGAAATTCGGCGACCTCCTTTGAGTCCTTCTCAAATCAGACGTCTTCCAAGTTCCAAAGTTCCAATCTGAAATCGAGACTACCTTCGTTCTAATCCACAGCCACTGAGAGAGAACTCGACATCTACAA...
2415 bp · TkA08G185810|TK1151|CDS
ATGGAGTCTCAAAGATCTAATCTTCAAGTAGTTTCCCTAAATGACGATGACGATGAAATATTGGTTTCCAAGTTCGATTGTTCAGTCGACAATCACTTTCACGCGATGGATAAAATTGCTACACTCTCCGGAGAATCAGAACCACAAACCGACATTCCACGATTCTCTTCTTCCGTTACTTTCTTAAGAGAATGGAGAAACTTCTGTTACCAACCTCGAGCTGTTAGGTTTGCTTGTGAAAAGGACACAGATGTCGCACC...
Protein
Download Protein FASTA804 aa · TkA08G185810|TK1151|PROTEIN
MESQRSNLQVVSLNDDDDEILVSKFDCSVDNHFHAMDKIATLSGESEPQTDIPRFSSSVTFLREWRNFCYQPRAVRFACEKDTDVAPQINLPQFSSALVPKDSSDGNKDFVMNVGGHVWALDWCPKLHQNSNTNINVEFIAVAAHPPESSYHKIGAPLTGRGLIQIWCMLNSCTKEQDKLPLVKVKPKKSSQNDESTDPEIDEPKKKRGRPKKITVPNQQDIIPLVKVKPKKSSRNDESTDPEIDEPKKKRGRPKKITVP...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G185810 |
|---|---|
| TK1151 ID | TkA08G185810 |
| OH-1004 ID | LXL04_032544 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 97.100 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G185810 |
|---|---|
| Location | Chr08:48565708-48570441 (+) |
| Description | Similar to GTF3C2: General transcription factor 3C polypeptide 2 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006383 transcription by RNA polymerase III Biological Process GO:0006384 transcription initiation at RNA polymerase III promoter Biological Process GO:0042791 5S class rRNA transcription by RNA polymerase III Biological Process GO:0042797 tRNA transcription by RNA polymerase III Biological Process GO:0000127 transcription factor TFIIIC complex Cellular Component GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0000995 RNA polymerase III general transcription initiation factor activity Molecular Function GO:0003677 DNA binding Molecular Function |
| KEGG gene cross-reference | hsa:2976 mmu:71752 pon:100174311 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00400WD40112-125 aaPF23381Beta-prop_IFT122_1st115-143 aaPF24807WD40_CDC20-Fz117-126 aaPF13565HTH_32203-234 aaPF13565HTH_32247-273 aaPF00400WD40374-389 aaPF23381Beta-prop_IFT122_1st376-413 aaPF24807WD40_CDC20-Fz459-522 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G185810 | PF00400 | WD40 | 112 | 125 | 1e-06 | 29.7 |
| TkA08G185810 | PF23381 | Beta-prop_IFT122_1st | 115 | 143 | 1.2e-06 | 28.8 |
| TkA08G185810 | PF24807 | WD40_CDC20-Fz | 117 | 126 | 2e-05 | 24.7 |
| TkA08G185810 | PF13565 | HTH_32 | 203 | 234 | 0.31 | 12.4 |
| TkA08G185810 | PF13565 | HTH_32 | 247 | 273 | 0.31 | 12.4 |
| TkA08G185810 | PF00400 | WD40 | 374 | 389 | 1e-06 | 29.7 |
| TkA08G185810 | PF23381 | Beta-prop_IFT122_1st | 376 | 413 | 1.2e-06 | 28.8 |
| TkA08G185810 | PF24807 | WD40_CDC20-Fz | 459 | 522 | 2e-05 | 24.7 |
| TkA08G185810 | PF23775 | Beta-prop_RIG_2nd | 459 | 488 | 0.0043 | 17.2 |
| TkA08G185810 | PF23383 | Beta-prop_IFT140_1st | 461 | 488 | 0.003 | 17.0 |
| TkA08G185810 | PF00400 | WD40 | 467 | 483 | 1e-06 | 29.7 |
| TkA08G185810 | PF25173 | Beta-prop_WDR3_1st | 467 | 485 | 0.062 | 13.7 |
| TkA08G185810 | PF23381 | Beta-prop_IFT122_1st | 469 | 589 | 1.2e-06 | 28.8 |
| TkA08G185810 | PF23414 | Beta-prop_EML_2 | 469 | 484 | 9.5e-06 | 25.9 |
| TkA08G185810 | PF25174 | Beta-prop_THOC3 | 470 | 591 | 7.1e-06 | 25.9 |
| TkA08G185810 | PF00400 | WD40 | 506 | 544 | 1e-06 | 29.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.