TkA08G184990 | RubberDandelionOmics

Gene overview

TkA08G184990

Reference: TK1151 Chr: Chr08 Coordinates: 48337063-48342251 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4017 bp · TkA08G184990|TK1151|cDNA

AACGCAGGGTTCTTCGAATCGTTTCATTTTGGATAACAAATCAGATCAAACCCAAACCGACTTTACATTGAAGTAAAAGTTTCATCACGAATCCGAACGAAAATAACTGCTAGATTATACATATTTTATGCCCCATTTCTTCAAGAGATTCATCAGAAAATAAGTCAACAACAATCGTCAGGTTTAATGTCTTCGTTCCGCCGGAGATGTCGCCGCCGGCGTTTCTAGATTCATGCAACGGTCAGTTTTTTTCTTTCAAA...

CDS

Download CDS FASTA

3639 bp · TkA08G184990|TK1151|CDS

ATGTCGCCGCCGGCGTTTCTAGATTCATGCAACGGTCAGTTTTTTTCTTTCAAATCGTCTTCGGCGTTGTATTCTTCCTACACCGATATGAACTCTTCGTCATCGAATTCGAATTACGGATTTCCCAATTCGAATGAAACGAATACCATTTCGGGGTTTAATTCGCCGCCTTTAGCGGCTTCTAGGAATCCAGGGGGAGCCGCTGTAGCTGGTCCAGGTTCAAATCTATCACGGCCACGGCTTATGAAGATGAGAAGACA...

Protein

Download Protein FASTA

1212 aa · TkA08G184990|TK1151|PROTEIN

MSPPAFLDSCNGQFFSFKSSSALYSSYTDMNSSSSNSNYGFPNSNETNTISGFNSPPLAASRNPGGAAVAGPGSNLSRPRLMKMRRQASHNPRSTTASGIRRGEEADASLGFNPFRTPSESAFVNSTLENAPKRAFSFGSASSNSAPFSFHAFQSDNKKNLDESMADQLPDEINKLNIGGSGNVNSMNSQFTNTFPSNTAPFSFKDFKSENKQNLDASMVDQLPNEIKKLNIGGSGKVNHTKSQSTNTFPSNVETDLQHE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G184990`
TK1151 ID	TkA08G184990
OH-1004 ID	LXL04_032531
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	97.400
Protein coverage (%)	TK1151 100.000 / OH-1004 67.559 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G184990`
Location	Chr08:48337063-48342251 (-)
Description	Similar to DNAJC7: DnaJ homolog subfamily C member 7
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_032531` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006457 protein folding Biological Process GO:1900034 regulation of cellular response to heat Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0005856 cytoskeleton Cellular Component GO:0016020 membrane Cellular Component GO:0045335 phagocytic vesicle Cellular Component GO:0070062 extracellular exosome Cellular Component GO:0001671 ATPase activator activity Molecular Function GO:0031072 heat shock protein binding Molecular Function
KEGG gene cross-reference	ddi:DDB_G0288639 hsa:7266 mmu:56354 pon:100173101 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.566

Rank 1 · TkA08G184990 · TK1151

Nucleus0.365

Rank 2 · TkA08G184990 · TK1151

Cell membrane0.097

Rank 3 · TkA08G184990 · TK1151

Golgi apparatus0.063

Rank 4 · TkA08G184990 · TK1151

Endoplasmic reticulum0.056

Rank 5 · TkA08G184990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04212MIT152-163 aa

PF03486HI0933_like158-198 aa

PF03486HI0933_like211-255 aa

PF29407CFAP70_TPR_C657-768 aa

PF28559TPR_SusR664-708 aa

PF07719TPR_2672-702 aa

PF13371TPR_9672-706 aa

PF25575TPR_BSK1_C673-748 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G184990	`PF04212`	MIT	152	163	0.14	12.9
TkA08G184990	`PF03486`	HI0933_like	158	198	0.14	12.4
TkA08G184990	`PF03486`	HI0933_like	211	255	0.14	12.4
TkA08G184990	`PF29407`	CFAP70_TPR_C	657	768	0.0096	16.2
TkA08G184990	`PF28559`	TPR_SusR	664	708	2.8e-05	24.5
TkA08G184990	`PF07719`	TPR_2	672	702	1.9e-15	56.3
TkA08G184990	`PF13371`	TPR_9	672	706	0.022	15.5
TkA08G184990	`PF25575`	TPR_BSK1_C	673	748	1.5e-06	28.8
TkA08G184990	`PF00515`	TPR_1	674	698	7.9e-19	67.3
TkA08G184990	`PF13428`	TPR_14	674	705	2.1e-05	25.5
TkA08G184990	`PF13432`	TPR_16	676	696	0.00013	23.1
TkA08G184990	`PF10952`	DUF2753	676	735	0.00028	21.8
TkA08G184990	`PF13424`	TPR_12	684	699	1.4e-05	25.9
TkA08G184990	`PF13181`	TPR_8	684	698	4.9e-05	23.9
TkA08G184990	`PF13176`	TPR_7	685	698	0.18	12.7
TkA08G184990	`PF04212`	MIT	692	722	0.14	12.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card