TkA08G184880 | RubberDandelionOmics

Gene overview

TkA08G184880

Reference: TK1151 Chr: Chr08 Coordinates: 48299773-48302742 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2198 bp · TkA08G184880|TK1151|cDNA

GCGATCAATTTTAACAAATTGATTTTAGATGGAGGAATCAATTTGATAAATGAAAATTGCACATTCACTTTCTAAAATAATATAATTTATTATCTTTTTGTTGATCTGTTAAAACCCCTTTCAAAACCTCTCAGATATCCTATCCAGTTGCTACAACGACCTCTAGTTCAATTGTTAAACCGGCGACGCCGTCACACGGTCCCTCGACTTGCCTCCGAACGAGCACAACTACCGTACGAGCCTCTTCATCGACGCAACAG...

CDS

Download CDS FASTA

1680 bp · TkA08G184880|TK1151|CDS

ATGGCCGCGTCACTCCCTCACACTCTCCCCATTCCTCGCCGCCGTCATTCTTCCGTTTCACATATCAATAAGCAGTTCCTTAACATATACCGCTTTGACCCCAACTTCAATGGTCAAAGACGAGCAAAGGTGGTCTGTCAAGGCATGTTGGCACCCCGAAAGTTTATGCAAAGAAGGAAAAAGATAGAAGTCTTCGAGGATGATGCTGATGAAGAAGATCAAAAGAGCTGGAGGAAGATGATGAATGAAATCGATGAGGT...

Protein

Download Protein FASTA

559 aa · TkA08G184880|TK1151|PROTEIN

MAASLPHTLPIPRRRHSSVSHINKQFLNIYRFDPNFNGQRRAKVVCQGMLAPRKFMQRRKKIEVFEDDADEEDQKSWRKMMNEIDEVGSAVSVLRTRRTKNQPLPKDLVLGTLVRFKQQKKWNIVAEILEWLRTQHWWNFNEMDALMLITAYGKEGDFNKAERVFSYINKKGYPPSVISHTALMEAYGKGGQCNKAEAIFRRMQSSGPEPSAVTYQIILKIFVQADKFKEAEETFEAILTDEVSTLKPDQQMFHMMIYMY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G184880`
TK1151 ID	TkA08G184880
OH-1004 ID	LXL04_032527
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G184880

Location Chr08:48299773-48302742 (+)

Description Similar to At3g59040: Pentatricopeptide repeat-containing protein At3g59040

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g59040`	Pentatricopeptide repeat-containing protein At3g59040.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032527 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006396 RNA processing Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT3G59040

ath:AT5G02860

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.763

Rank 1 · TkA08G184880 · TK1151

Mitochondrion0.130

Rank 2 · TkA08G184880 · TK1151

Nucleus0.061

Rank 3 · TkA08G184880 · TK1151

Cytoplasm0.016

Rank 4 · TkA08G184880 · TK1151

Cell membrane0.010

Rank 5 · TkA08G184880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29861F37A465-98 aa

PF19189Mtf258-84 aa

PF03235GmrSD_N60-174 aa

PF13812PPR_3116-133 aa

PF06239ECSIT_N144-223 aa

PF13428TPR_14146-165 aa

PF13812PPR_3147-189 aa

PF12854PPR_1147-166 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G184880	`PF29861`	F37A46	5	98	4.0	7.2
TkA08G184880	`PF19189`	Mtf2	58	84	0.058	13.8
TkA08G184880	`PF03235`	GmrSD_N	60	174	0.00015	22.7
TkA08G184880	`PF13812`	PPR_3	116	133	6.7e-50	167.7
TkA08G184880	`PF06239`	ECSIT_N	144	223	5.6e-06	26.5
TkA08G184880	`PF13428`	TPR_14	146	165	3.4e-07	31.0
TkA08G184880	`PF13812`	PPR_3	147	189	6.7e-50	167.7
TkA08G184880	`PF12854`	PPR_1	147	166	2.9e-47	158.8
TkA08G184880	`PF24760`	TPR_IF140_C	147	164	7.6	7.7
TkA08G184880	`PF13041`	PPR_2	148	188	8.1e-72	237.9
TkA08G184880	`PF01535`	PPR	148	172	3.7e-54	178.0
TkA08G184880	`PF29070`	MSC6_N	149	236	3.1e-28	99.7
TkA08G184880	`PF17177`	PPR_long	149	225	1.6e-25	90.5
TkA08G184880	`PF23276`	TPR_24	150	239	3.1e-25	89.3
TkA08G184880	`PF14559`	TPR_19	155	210	0.0049	17.9
TkA08G184880	`PF26578`	LLG1	161	181	0.049	14.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LYT2`	Arabidopsis thaliana	sp\|Q9LYT2\|PP287_ARATH Pentatricopeptide repeat-containing protein At3g59040	71.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card