TkA08G184860 | RubberDandelionOmics

Gene overview

TkA08G184860

Reference: TK1151 Chr: Chr08 Coordinates: 48292962-48296879 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1837 bp · TkA08G184860|TK1151|cDNA

GGGAAACCCCTACTACATATCGATCCCTCAATCTCTCCCATTCGCACACCGCTCACTCTCTCTCCTTCTAGGTTTTCTCACTCAAAAACAATGAACGAAAACGGACAGGAGTCGTCTCTTTCGGATTTTGAAGCCGCTCGGAGTAATCTTCGTCAGCGTTGGGAGTTGGCTTCTGTTCTCAATTTCTTCAAGGTGTTTGAGCCTGTTATAGAAAGCAATCTGAAGATTTCTGCTGAAGAGATTGAGACTTCACTCATTCA...

CDS

Download CDS FASTA

1500 bp · TkA08G184860|TK1151|CDS

ATGAACGAAAACGGACAGGAGTCGTCTCTTTCGGATTTTGAAGCCGCTCGGAGTAATCTTCGTCAGCGTTGGGAGTTGGCTTCTGTTCTCAATTTCTTCAAGGTGTTTGAGCCTGTTATAGAAAGCAATCTGAAGATTTCTGCTGAAGAGATTGAGACTTCACTCATTCAACCAAACAAATCTCTTGCTCAGATTCACATAGCACTCTTAAAGGGAATCCCGCCTGTAAATAAAAACCTAAAAGATCCAGATGCATGGGT...

Protein

Download Protein FASTA

499 aa · TkA08G184860|TK1151|PROTEIN

MNENGQESSLSDFEAARSNLRQRWELASVLNFFKVFEPVIESNLKISAEEIETSLIQPNKSLAQIHIALLKGIPPVNKNLKDPDAWVVSLSKKLIMWWPWVAEGDFPLTADKGAEMATYKKLDPTIRLVVLKALCEIRADQHDVVSYINEGVKTKNEMSTFRKTNIGEDGKGTSYWCDGNEVIGFRLYKEFNTFKKNAISCQWETLATNLEEFQIVVDEYSSSKSKLEVAVSVAVENEVMPALNKLEKKRQKALQKKMHE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G184860`
TK1151 ID	TkA08G184860
OH-1004 ID	LXL04_032526
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G184860

Location Chr08:48292962-48296879 (-)

Description Similar to DDR4: DDT domain-containing protein DDR4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g18950`	Probable transcription regulator.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032526 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007156 homophilic cell-cell adhesion Biological Process

GO:0031507 heterochromatin formation Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0016020 membrane Cellular Component

GO:0031010 ISWI-type complex Cellular Component

GO:0031213 RSF complex Cellular Component

GO:0005509 calcium ion binding Molecular Function

GO:0030246 carbohydrate binding Molecular Function

GO:0042393 histone binding Molecular Function

KEGG gene cross-reference

ath:AT1G18950

hwa:HQ_1081A

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.950

Rank 1 · TkA08G184860 · TK1151

Cytoplasm0.136

Rank 2 · TkA08G184860 · TK1151

Cell membrane0.020

Rank 3 · TkA08G184860 · TK1151

Mitochondrion0.016

Rank 4 · TkA08G184860 · TK1151

Endoplasmic reticulum0.008

Rank 5 · TkA08G184860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23450KIAA2026_hel25-100 aa

PF23450KIAA2026_hel115-142 aa

PF13103TonB_2286-315 aa

PF13103TonB_2338-361 aa

PF13103TonB_2437-456 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G184860	`PF23450`	KIAA2026_hel	25	100	0.06	14.3
TkA08G184860	`PF23450`	KIAA2026_hel	115	142	0.06	14.3
TkA08G184860	`PF13103`	TonB_2	286	315	9.1	7.2
TkA08G184860	`PF13103`	TonB_2	338	361	9.1	7.2
TkA08G184860	`PF13103`	TonB_2	437	456	9.1	7.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IDY7`	Arabidopsis thaliana	sp\|F4IDY7\|DDR4_ARATH DDT domain-containing protein DDR4	44.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card