TkA08G181940 | RubberDandelionOmics

Gene overview

TkA08G181940

Reference: TK1151 Chr: Chr08 Coordinates: 47573488-47573871 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

384 bp · TkA08G181940|TK1151|cDNA

ATGGAAGAAGCGGAGGCACATCTTTCACTACTGATCAAGCATATGACAGGAGACGATCGCGCCGAAACTTCTCTTCCAATCACCGGAGACATCCTCTCTAAAATCGTCGACTACTGCCGGAAGCACGTCAACACCGCCAACGACGATGAAGCTCTGAGATCGTTCGACAGTGAGTTCATGAATGTGGGTGAAGCGACTCTGTACCAAATGGCGAATGCGGCTAGGTTTCTCGACATCAAGAATTTGTCAAATATGCTTTG...

CDS

Download CDS FASTA

384 bp · TkA08G181940|TK1151|CDS

ATGGAAGAAGCGGAGGCACATCTTTCACTACTGATCAAGCATATGACAGGAGACGATCGCGCCGAAACTTCTCTTCCAATCACCGGAGACATCCTCTCTAAAATCGTCGACTACTGCCGGAAGCACGTCAACACCGCCAACGACGATGAAGCTCTGAGATCGTTCGACAGTGAGTTCATGAATGTGGGTGAAGCGACTCTGTACCAAATGGCGAATGCGGCTAGGTTTCTCGACATCAAGAATTTGTCAAATATGCTTTG...

Protein

Download Protein FASTA

127 aa · TkA08G181940|TK1151|PROTEIN

MEEAEAHLSLLIKHMTGDDRAETSLPITGDILSKIVDYCRKHVNTANDDEALRSFDSEFMNVGEATLYQMANAARFLDIKNLSNMLWEALADRREKRRSNPELYRRVPASRSSVIFRKRIDRRRIFL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G181940`
TK1151 ID	TkA08G181940
OH-1004 ID	LXL04_032497
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	93.700
Protein coverage (%)	TK1151 100.000 / OH-1004 61.650 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G181940

Location Chr08:47573488-47573871 (+)

Description Similar to ASK4: SKP1-like protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g20140`	Involved in ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At2g25700`	Involved in ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At5g42190`	Involved in ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At3g60010`	Involved in ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0456300`	Involved in ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032497 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000226 microtubule cytoskeleton organization Biological Process

GO:0000278 mitotic cell cycle Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0007059 chromosome segregation Biological Process

GO:0007140 male meiotic nuclear division Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009867 jasmonic acid mediated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0016567 protein ubiquitination Biological Process

KEGG gene cross-reference

ath:AT1G20140

ath:AT1G75950

ath:AT2G03170

ath:AT2G25700

ath:AT5G42190

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.516

Rank 1 · TkA08G181940 · TK1151

Nucleus0.422

Rank 2 · TkA08G181940 · TK1151

Mitochondrion0.092

Rank 3 · TkA08G181940 · TK1151

Cell membrane0.084

Rank 4 · TkA08G181940 · TK1151

Endoplasmic reticulum0.043

Rank 5 · TkA08G181940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03931Skp1_POZ2-44 aa

PF08545ACP_syn_III13-41 aa

PF08545ACP_syn_III64-86 aa

PF25120DUF781467-125 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G181940	`PF03931`	Skp1_POZ	2	44	1.2e-06	29.3
TkA08G181940	`PF08545`	ACP_syn_III	13	41	0.19	12.3
TkA08G181940	`PF08545`	ACP_syn_III	64	86	0.19	12.3
TkA08G181940	`PF25120`	DUF7814	67	125	0.15	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LNT9`	Arabidopsis thaliana	sp\|Q9LNT9\|ASK4_ARATH SKP1-like protein 4	36.700%	Swiss-Prot	Medium
`Q9SL93`	Arabidopsis thaliana	sp\|Q9SL93\|ASK3_ARATH SKP1-like protein 3	34.600%	Swiss-Prot	Medium
`Q9FHW7`	Arabidopsis thaliana	sp\|Q9FHW7\|SKP1B_ARATH SKP1-like protein 1B	33.600%	Swiss-Prot	Medium
`Q9M1X5`	Arabidopsis thaliana	sp\|Q9M1X5\|ASK13_ARATH SKP1-like protein 13	39.600%	Swiss-Prot	Medium
`Q6PL11`	Oryza sativa subsp. japonica	sp\|Q6PL11\|SKP1_ORYSJ SKP1-like protein 1	33.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card